close

SimulationCraft 801-02

for World of Warcraft 8.0.1 Live (wow build level 27980)

Current simulator hotfixes

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-05-02 Incorrect spell level for Icicle buff.
Icicles spell_level 78.00 80.00
2017-11-08 Incorrect spell level for Ignite.
Ignite spell_level 78.00 99.00
2017-11-06 Incorrect spell level for Icicle.
Icicle spell_level 78.00 80.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Current simulator-wide DBC data overrides

Spell / Effect Field Override Value DBC Value
Nether Portal duration 15000.00 20000.00
Nether Portal cast_max 0.00 2500.00
Demonic Consumption (effect#1) base_value 3.00 1.00
Demonfire (effect#1) sp_coefficient 0.36 0.33
From the Shadows (effect#1) base_value 50.00 20.00
Bilescourge Bombers (effect#1) sp_coefficient 0.19 0.14
Firebolt (effect#1) sp_coefficient 0.57 0.40
Shadow Bite (effect#1) sp_coefficient 0.51 0.30
Lash of Pain (effect#1) sp_coefficient 0.51 0.30
Consuming Shadows (effect#1) sp_coefficient 0.10 0.07
Legion Strike (effect#1) ap_coefficient 0.97 0.68
Demonology Warlock (effect#1) base_value 5.00 10.00
Demonology Warlock (effect#2) base_value 5.00 10.00
Demonology Warlock (effect#3) base_value 5.00 10.00

Table of Contents

Raid Summary

 

Actions per Minute / DPS Variance Summary

DL_GF_Felguard : 16685 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
16684.8 16684.8 15.5 / 0.093% 2151.9 / 12.9% 4.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
963.2 954.1 Mana 0.00% 47.3 100.0% 100%
Talents
  • 15: Dreadlash (Demonology Warlock)
  • 30: Demonic Calling (Demonology Warlock)
  • 60: Summon Vilefiend (Demonology Warlock)
  • 90: Grimoire: Felguard (Demonology Warlock)
  • 100: Nether Portal (Demonology Warlock)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
DL_GF_Felguard 16685
Demonbolt 1255 7.5% 44.2 6.20sec 8519 7487 Direct 45.0 7109 14220 8359 17.6%  

Stats details: demonbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.20 45.05 0.00 0.00 1.1377 0.0000 376550.64 376550.64 0.00 7487.44 7487.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.13 82.42% 7109.21 6520 8308 7110.37 6911 7302 263944 263944 0.00
crit 7.92 17.58% 14219.75 13040 16616 14217.19 0 16616 112607 112607 0.00
 
 

Action details: demonbolt

Static Values
  • id:264178
  • school:shadowflame
  • resource:mana
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:264178
  • name:Demonbolt
  • school:shadowflame
  • tooltip:
  • description:Send the fiery soul of a fallen demon at the enemy, causing {$s1=0} Shadowflame damage.$?c2[ |cFFFFFFFFGenerates 2 Soul Shards.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.667000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Hand of Gul'dan 1052 6.3% 60.4 4.90sec 5225 4740 Direct 60.3 4450 8892 5236 17.7%  

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.41 60.29 0.00 0.00 1.1023 0.0000 315644.98 315644.98 0.00 4740.05 4740.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.62 82.30% 4449.53 1634 5979 4443.61 4067 4793 220767 220767 0.00
crit 10.67 17.70% 8892.19 3267 11958 8879.78 3454 10867 94878 94878 0.00
 
 

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadowflame
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.7000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:2.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadowflame
  • tooltip:
  • description:Calls down a demonic meteor full of Wild Imps which burst forth to attack the target. Deals up to ${$m1*$86040m1} Shadowflame damage on impact to all enemies within $86040A1 yds of the target{$?s196283=false}[, applies Doom to each target,][] and summons up to ${$m1*{$104317m2=0}} Wild Imps, based on Soul Shards consumed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.160000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Heed My Call 140 (200) 0.8% (1.2%) 7.2 36.76sec 8286 0 Direct 7.2 4925 9849 5798 17.7%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.23 7.23 0.00 0.00 0.0000 0.0000 41925.77 41925.77 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.95 82.25% 4924.62 4925 4925 4923.64 0 4925 29287 29287 0.00
crit 1.28 17.75% 9849.24 9849 9849 7230.79 0 9849 12639 12639 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4620.00
  • base_dd_max:4620.00
 
    Heed My Call (_aoe) 60 0.4% 7.2 36.76sec 2488 0 Direct 7.2 2111 4221 2488 17.9%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.23 7.23 0.00 0.00 0.0000 0.0000 17985.50 17985.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.94 82.14% 2110.55 2111 2111 2110.55 2111 2111 12534 12534 0.00
crit 1.29 17.86% 4221.10 4221 4221 3089.62 0 4221 5451 5451 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1980.00
  • base_dd_max:1980.00
 
Shadow Bolt 1339 8.0% 95.7 3.06sec 4199 2810 Direct 95.0 3595 7188 4230 17.7%  

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.66 94.97 0.00 0.00 1.4946 0.0000 401700.65 401700.65 0.00 2809.78 2809.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.19 82.33% 3594.88 3373 4297 3595.47 3554 3657 281083 281083 0.00
crit 16.78 17.67% 7187.72 6745 8595 7189.00 6955 7580 120618 120618 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=0} Shadow damage.$?c2[ |cFFFFFFFFGenerates 1 Soul Shard.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.345000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Volatile Blood Explosion 287 1.7% 7.3 36.77sec 11862 0 Direct 7.2 10240 20481 12026 17.4%  

Stats details: volatile_blood_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.26 7.16 0.00 0.00 0.0000 0.0000 86153.67 86153.67 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.91 82.56% 10240.44 10240 10240 10236.34 0 10240 60572 60572 0.00
crit 1.25 17.44% 20480.88 20481 20481 14978.62 0 20481 25582 25582 0.00
 
 

Action details: volatile_blood_explosion

Static Values
  • id:278057
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278057
  • name:Volatile Blood Explosion
  • school:shadow
  • tooltip:
  • description:Your damaging spells have a chance to launch an orb of charged blood at your target, dealing {$s1=4788} Shadow damage split among all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9607.38
  • base_dd_max:9607.38
 
pet - felguard 2636 / 2636
Felstorm 379 2.3% 10.4 30.14sec 10907 2894 Periodic 62.1 1553 3106 1829 17.8% 13.1%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.41 0.00 62.09 62.09 3.7689 0.6319 113546.26 162328.01 30.05 2894.00 2894.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.0 82.22% 1552.74 1454 1910 1552.69 1523 1598 79267 113322 30.05
crit 11.0 17.78% 3105.62 2908 3820 3104.92 0 3436 34279 49006 30.05
 
 

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $ Physical damage every $t1 sec. Unable to use other abilities.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc89751=The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Legion Strike 1061 6.4% 58.4 5.10sec 5445 5421 Direct 58.4 4626 9247 5445 17.7%  

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.39 58.39 0.00 0.00 1.0045 0.0000 317944.98 454540.53 30.05 5420.78 5420.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.04 82.28% 4626.11 4179 5592 4626.84 4514 4745 222244 317724 30.05
crit 10.35 17.72% 9247.15 8359 11183 9247.48 8513 10367 95701 136817 30.05
 
 

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy>=100
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w2%.
  • description:A strong attack that deals $<damage> damage to all enemies in front of it, and reduces the effectiveness of any healing the victim receives by {$s2=10}% for {$d=6 seconds}. |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1196 7.2% 173.6 1.71sec 2065 1393 Direct 173.6 1756 3513 2065 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 173.60 173.60 0.00 0.00 1.4828 0.0000 358540.59 512576.83 30.05 1392.82 1392.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 143.05 82.40% 1756.11 1586 2122 1756.41 1727 1785 251214 359141 30.05
crit 30.55 17.60% 3512.85 3173 4245 3513.34 3333 3753 107326 153436 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - grimoire_felguard 4422 / 957
Felstorm 710 0.9% 3.9 80.87sec 11583 3956 Periodic 19.5 1988 3978 2345 17.9% 3.8%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.94 0.00 19.46 19.46 2.9279 0.5928 45640.73 65248.90 30.05 3956.03 3956.03
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.0 82.08% 1988.40 1864 2388 1989.09 1906 2180 31766 45413 30.05
crit 3.5 17.92% 3977.80 3728 4775 3899.31 0 4775 13875 19836 29.44
 
 

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $ Physical damage every $t1 sec. Unable to use other abilities.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc89751=The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Legion Strike 2005 2.6% 18.4 13.87sec 7005 7006 Direct 18.4 5953 11907 7005 17.7%  

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.42 18.42 0.00 0.00 1.0000 0.0000 129069.45 184520.28 30.05 7005.51 7005.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.17 82.33% 5953.31 5456 6990 5955.77 5657 6459 90304 129100 30.05
crit 3.26 17.67% 11906.56 10913 13979 11576.03 0 13979 38766 55420 29.20
 
 

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy>=100
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w2%.
  • description:A strong attack that deals $<damage> damage to all enemies in front of it, and reduces the effectiveness of any healing the victim receives by {$s2=10}% for {$d=6 seconds}. |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1707 2.2% 40.9 6.38sec 2684 2268 Direct 40.9 2280 4560 2685 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.89 40.89 0.00 0.00 1.1839 0.0000 109776.24 156938.32 30.05 2267.59 2267.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.63 82.25% 2279.72 2071 2653 2280.43 2219 2419 76678 109620 30.05
crit 7.26 17.75% 4560.00 4142 5306 4559.54 0 5126 33098 47318 30.04
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - shivarra 1933 / 256
melee 835 0.7% 41.8 2.58sec 782 665 Direct 41.8 665 1331 782 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.81 41.81 0.00 0.00 1.1752 0.0000 32683.20 46724.55 30.05 665.27 665.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.47 82.45% 664.96 587 717 665.64 587 714 22920 32767 30.05
crit 7.34 17.55% 1330.62 1175 1433 1313.97 0 1433 9763 13958 29.63
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 418 0.3% 41.8 2.58sec 392 315 Direct 41.8 333 665 392 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.81 41.81 0.00 0.00 1.2425 0.0000 16367.43 23399.21 30.05 315.10 315.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.39 82.25% 332.53 294 358 332.88 294 357 11434 16346 30.05
crit 7.42 17.75% 664.89 587 717 653.64 0 717 4933 7053 29.51
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Multi-Slash 0 (90) 0.0% (0.5%) 0.0 0.00sec 0 3968

Stats details: multislash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 3968.50 3968.50
 
 

Action details: multislash

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (1) 170 0.1% 6.7 17.20sec 992 0 Direct 6.7 844 1689 992 17.5%  

Stats details: multislash1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.74 6.74 0.00 0.00 0.0000 0.0000 6692.86 9568.25 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.56 82.46% 844.04 749 914 841.26 0 914 4694 6711 29.90
crit 1.18 17.54% 1689.47 1498 1827 1124.57 0 1827 1998 2857 19.99
 
 

Action details: multislash1

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (2) 170 0.1% 6.7 17.20sec 992 0 Direct 6.7 844 1689 992 17.6%  

Stats details: multislash2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.74 6.74 0.00 0.00 0.0000 0.0000 6693.24 9568.79 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.56 82.45% 844.12 749 914 842.33 0 914 4694 6711 29.93
crit 1.18 17.55% 1688.71 1498 1827 1113.86 0 1827 1999 2858 19.82
 
 

Action details: multislash2

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (3) 170 0.1% 6.7 17.20sec 991 0 Direct 6.7 844 1686 991 17.4%  

Stats details: multislash3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.74 6.74 0.00 0.00 0.0000 0.0000 6684.52 9556.33 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.57 82.58% 844.38 749 914 843.40 0 914 4703 6723 29.97
crit 1.18 17.42% 1686.25 1498 1827 1125.78 0 1827 1982 2833 20.06
 
 

Action details: multislash3

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (4) 170 0.1% 6.7 17.20sec 992 0 Direct 6.7 844 1689 992 17.5%  

Stats details: multislash4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.74 6.74 0.00 0.00 0.0000 0.0000 6692.92 9568.34 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.56 82.45% 844.14 749 914 842.17 0 914 4694 6711 29.93
crit 1.18 17.55% 1688.54 1498 1827 1136.93 0 1827 1999 2857 20.21
 
 

Action details: multislash4

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - illidari_satyr 1272 / 172
melee 420 0.3% 42.8 2.60sec 391 332 Direct 42.8 332 665 391 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.82 42.82 0.00 0.00 1.1793 0.0000 16748.67 23944.23 30.05 331.65 331.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.26 82.33% 332.35 294 358 332.74 294 357 11717 16752 30.05
crit 7.57 17.67% 664.86 587 717 656.32 0 717 5031 7193 29.64
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 210 0.2% 42.8 2.60sec 195 157 Direct 42.8 166 332 195 17.6%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.82 42.82 0.00 0.00 1.2465 0.0000 8369.80 11965.63 30.05 156.79 156.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.28 82.39% 166.17 147 179 166.36 147 178 5863 8382 30.05
crit 7.54 17.61% 332.44 294 358 327.51 0 358 2507 3583 29.57
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Shadow Slash 642 0.5% 9.2 12.50sec 2817 2817 Direct 9.2 2395 4789 2817 17.6%  

Stats details: shadow_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.16 9.16 0.00 0.00 1.0000 0.0000 25815.75 25815.75 0.00 2817.39 2817.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.55 82.38% 2395.49 2116 2582 2396.97 0 2582 18085 18085 0.00
crit 1.61 17.62% 4789.25 4233 5163 3645.48 0 5163 7731 7731 0.00
 
 

Action details: shadow_slash

Static Values
  • id:272012
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272012
  • name:Shadow Slash
  • school:shadow
  • tooltip:
  • description:The Satyr strikes at out with its weapons, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - vilefiend 3208 / 1517
Bile Spit 1169 3.3% 6.8 47.23sec 24304 0 Direct 6.8 8930 17867 10518 17.8%  
Periodic 33.2 2822 0 2822 0.0% 22.1%

Stats details: bile_spit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.78 6.77 33.17 33.17 0.0000 2.0000 164818.17 164818.17 0.00 2484.82 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.57 82.23% 8929.62 8474 10104 8926.82 0 9801 49712 49712 0.00
crit 1.20 17.77% 17866.88 16947 20207 13081.89 0 20207 21501 21501 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.2 100.00% 2822.41 2502 3310 2823.10 2632 2885 93605 93605 0.00
 
 

Action details: bile_spit

Static Values
  • id:267997
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:65.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267997
  • name:Bile Spit
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:The Vilefiend spits a ball of bile at its target, dealing ${$m1*$<demoMastery>} Nature damage and an additional ${$m2*$<demoMastery>} Nature damage every $t2 sec for {$d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.680000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.200000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Headbutt 734 2.1% 28.5 10.27sec 3652 3652 Direct 28.5 3106 6210 3652 17.6%  

Stats details: headbutt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.51 28.51 0.00 0.00 1.0000 0.0000 104101.59 148825.73 30.05 3651.92 3651.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.49 82.41% 3105.77 2737 3621 3107.26 2938 3235 72960 104305 30.05
crit 5.01 17.59% 6210.50 5474 7243 6182.29 0 7243 31142 44521 29.90
 
 

Action details: headbutt

Static Values
  • id:267999
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267999
  • name:Headbutt
  • school:physical
  • tooltip:
  • description:The Vilefiend rams its bladed head into the target, dealing {$s1=0} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1306 3.7% 102.7 2.82sec 1802 1354 Direct 102.7 1531 3061 1802 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 102.72 102.72 0.00 0.00 1.3310 0.0000 185054.48 264557.60 30.05 1353.54 1353.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.54 82.30% 1530.72 1337 1775 1531.30 1475 1572 129409 185006 30.05
crit 18.18 17.70% 3061.28 2673 3550 3062.67 2823 3309 55645 79552 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - vicious_hellhound 1057 / 140
Demon Fangs 652 0.5% 9.1 12.50sec 2819 2819 Direct 9.1 2392 4790 2819 17.8%  

Stats details: demon_fangs

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.12 9.12 0.00 0.00 1.0000 0.0000 25712.75 25712.75 0.00 2819.07 2819.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.50 82.20% 2392.15 2116 2582 2394.20 0 2582 17936 17936 0.00
crit 1.62 17.80% 4789.97 4233 5163 3631.18 0 5163 7776 7776 0.00
 
 

Action details: demon_fangs

Static Values
  • id:272013
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272013
  • name:Demon Fangs
  • school:shadowflame
  • tooltip:
  • description:The Vicious Hellhound chomps at its target, dealing Shadowflame damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 405 0.3% 80.9 1.36sec 196 325 Direct 80.9 166 333 196 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.93 80.93 0.00 0.00 0.6025 0.0000 15851.56 22661.71 30.05 325.07 325.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.65 82.36% 166.50 147 179 166.66 147 178 11097 15865 30.05
crit 14.28 17.64% 332.99 294 358 332.54 0 358 4754 6797 29.97
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - dreadstalker 3639 / 2405
Dreadbite 1334 5.3% 29.1 20.93sec 9080 0 Direct 29.1 7720 15438 9080 17.6%  

Stats details: dreadbite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.09 29.09 0.00 0.00 0.0000 0.0000 264175.91 264175.91 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.96 82.37% 7719.51 7139 9517 7719.82 7424 7965 184991 184991 0.00
crit 5.13 17.63% 15437.86 14278 19033 15372.91 0 19033 79185 79185 0.00
 
 

Action details: dreadbite

Static Values
  • id:205196
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205196
  • name:Dreadbite
  • school:shadow
  • tooltip:
  • description:Bite the target, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 2305 9.2% 312.1 1.89sec 1464 1106 Direct 312.1 1244 2488 1464 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 312.05 312.05 0.00 0.00 1.3240 0.0000 456884.22 653170.85 30.05 1105.86 1105.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 256.78 82.29% 1243.77 1101 1473 1243.95 1229 1264 319373 456583 30.05
crit 55.28 17.71% 2487.71 2203 2947 2487.97 2395 2604 137511 196588 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.83
 
pet - wild_imp 2578 / 2478
Fel Firebolt 2578 14.9% 995.8 0.29sec 746 502 Direct 991.7 637 1274 750 17.7%  

Stats details: fel_firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 995.81 991.67 0.00 0.00 1.4876 0.0000 743326.78 743326.78 0.00 501.77 501.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 816.48 82.33% 637.05 569 761 637.07 626 649 520133 520133 0.00
crit 175.19 17.67% 1274.01 1138 1523 1274.08 1240 1313 223194 223194 0.00
 
 

Action details: fel_firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Fel Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.046000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - demonic_tyrant 4661 / 824
Demonfire 4661 4.9% 37.7 6.91sec 6536 4891 Direct 37.7 5561 11120 6551 17.8%  

Stats details: demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.75 37.66 0.00 0.00 1.3364 0.0000 246739.81 246739.81 0.00 4890.88 4890.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.96 82.19% 5560.92 5312 5917 5564.13 5455 5673 172145 172145 0.00
crit 6.71 17.81% 11119.89 10624 11834 11113.83 0 11834 74594 74594 0.00
 
 

Action details: demonfire

Static Values
  • id:270481
  • school:shadowflame
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:270481
  • name:Demonfire
  • school:shadowflame
  • tooltip:
  • description:Deal {$s1=0} Shadowflame damage to your enemy target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.357500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - darkhound 1304 / 175
Fel Bite 467 0.4% 8.8 13.28sec 2113 2113 Direct 8.8 1796 3594 2113 17.6%  

Stats details: fel_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.81 8.81 0.00 0.00 1.0000 0.0000 18604.95 26598.00 30.05 2113.00 2113.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.25 82.38% 1795.98 1586 1935 1795.10 0 1935 13029 18626 29.97
crit 1.55 17.62% 3594.02 3172 3870 2666.65 0 3870 5576 7972 22.28
 
 

Action details: fel_bite

Static Values
  • id:272435
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272435
  • name:Fel Bite
  • school:physical
  • tooltip:
  • description:The Darkhound bites its target, causing serious Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 837 0.7% 42.2 2.67sec 782 666 Direct 42.2 665 1330 782 17.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.24 42.24 0.00 0.00 1.1745 0.0000 33017.91 47203.07 30.05 665.60 665.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.83 82.47% 665.24 587 717 666.16 587 714 23171 33126 30.05
crit 7.41 17.53% 1329.76 1175 1433 1317.19 0 1433 9847 14077 29.73
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - wrathguard 1715 / 232
melee 831 0.7% 42.5 2.69sec 782 663 Direct 42.5 665 1329 782 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.53 42.53 0.00 0.00 1.1784 0.0000 33248.86 47533.23 30.05 663.36 663.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.05 82.39% 664.83 587 717 665.54 587 714 23299 33309 30.05
crit 7.49 17.61% 1328.65 1175 1433 1306.46 0 1433 9950 14224 29.51
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 416 0.3% 42.5 2.69sec 391 314 Direct 42.5 332 665 391 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.53 42.53 0.00 0.00 1.2460 0.0000 16639.98 23788.84 30.05 313.99 313.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.00 82.30% 332.37 294 358 332.79 294 357 11634 16632 30.05
crit 7.53 17.70% 664.75 587 717 657.06 0 717 5006 7157 29.68
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Overhead Assault 468 0.4% 8.9 13.26sec 2114 2114 Direct 8.9 1794 3588 2114 17.8%  

Stats details: overhead_assault

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.93 8.93 0.00 0.00 1.0000 0.0000 18871.74 26979.42 30.05 2114.01 2114.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.34 82.20% 1794.50 1586 1935 1795.53 0 1935 13168 18826 30.00
crit 1.59 17.80% 3588.19 3172 3870 2694.15 0 3870 5703 8154 22.54
 
 

Action details: overhead_assault

Static Values
  • id:272432
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272432
  • name:Overhead Assault
  • school:physical
  • tooltip:
  • description:The Wrathguard smashes its target with a heavy overhand swing.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - void_terror 1832 / 247
Double Breath 0 (134) 0.0% (0.8%) 0.0 0.00sec 0 7415

Stats details: double_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 7414.78 7414.78
 
 

Action details: double_breath

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (1) 495 0.4% 7.0 16.84sec 2811 0 Direct 7.0 2390 4775 2811 17.7%  

Stats details: double_breath1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.02 7.02 0.00 0.00 0.0000 0.0000 19718.97 19718.97 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.78 82.34% 2389.63 2116 2582 2383.37 0 2582 13802 13802 0.00
crit 1.24 17.66% 4774.68 4233 5163 3256.24 0 5163 5916 5916 0.00
 
 

Action details: double_breath1

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (2) 494 0.4% 7.0 16.84sec 2813 0 Direct 7.0 2389 4777 2813 17.8%  

Stats details: double_breath2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.02 7.02 0.00 0.00 0.0000 0.0000 19735.08 19735.08 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.77 82.25% 2389.42 2116 2582 2385.37 0 2582 13786 13786 0.00
crit 1.25 17.75% 4776.66 4233 5163 3193.49 0 5163 5949 5949 0.00
 
 

Action details: double_breath2

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
melee 843 0.7% 42.6 2.59sec 784 668 Direct 42.6 665 1330 784 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.63 42.63 0.00 0.00 1.1740 0.0000 33414.90 47770.62 30.05 667.59 667.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.02 82.15% 665.01 587 717 665.93 587 713 23292 33298 30.05
crit 7.61 17.85% 1330.28 1175 1433 1314.23 0 1433 10123 14472 29.65
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - bilescourge 3926 / 522
Toxic Bile 3926 3.1% 54.6 2.00sec 2826 3040 Direct 54.6 2402 4802 2826 17.7%  

Stats details: toxic_bile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.61 54.61 0.00 0.00 0.9297 0.0000 154334.18 154334.18 0.00 3039.81 3039.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.96 82.33% 2401.91 2116 2582 2403.90 2116 2571 107999 107999 0.00
crit 9.65 17.67% 4802.05 4233 5163 4778.96 0 5163 46335 46335 0.00
 
 

Action details: toxic_bile

Static Values
  • id:272167
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272167
  • name:Toxic Bile
  • school:nature
  • tooltip:
  • description:The Bilescourge spits wads of Toxic Bile at its target, dealing Nature damage.
 
pet - urzul 1341 / 180
Many Faced Bite 502 0.4% 9.5 12.13sec 2108 2108 Direct 9.5 1792 3585 2108 17.6%  

Stats details: many_faced_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.49 9.49 0.00 0.00 1.0000 0.0000 20008.02 28603.87 30.05 2108.10 2108.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.82 82.39% 1792.21 1586 1935 1793.05 0 1935 14015 20037 30.02
crit 1.67 17.61% 3585.13 3172 3870 2744.09 0 3870 5993 8567 22.97
 
 

Action details: many_faced_bite

Static Values
  • id:272439
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272439
  • name:Many Faced Bite
  • school:physical
  • tooltip:
  • description:The Ur'zul rears up and bites its target, dealing Physical damage. You're not sure which face actually bit you after thinking about it.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 839 0.7% 42.6 2.62sec 782 662 Direct 42.6 665 1329 782 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.59 42.59 0.00 0.00 1.1800 0.0000 33285.66 47585.85 30.05 662.36 662.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.10 82.41% 664.70 587 717 665.39 587 714 23328 33350 30.05
crit 7.49 17.59% 1329.25 1175 1433 1311.00 0 1433 9958 14236 29.61
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - eye_of_guldan 995 / 81
Eye of Gul'dan 995 0.5% 27.4 5.60sec 876 1152 Periodic 59.9 400 0 400 0.0% 58.6%

Stats details: eye_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.37 0.00 59.93 59.93 0.7605 2.9354 23975.76 23975.76 0.00 121.87 1151.91
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.9 100.00% 400.05 181 461 399.10 379 405 23976 23976 0.00
 
 

Action details: eye_of_guldan

Static Values
  • id:272131
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272131
  • name:Eye of Gul'dan
  • school:shadowflame
  • tooltip:Suffering Shadow damage every $t1 sec.
  • description:The Eye of Gul'dan stares deep into the target's soul, causing Shadow Damage every $t1 sec for {$d=15 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.300000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - prince_malchezaar 4737 / 402
melee 3173 1.6% 21.4 1.44sec 3731 3180 Direct 21.4 3152 6314 3731 18.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.36 21.36 0.00 0.00 1.1733 0.0000 79701.37 113942.69 30.05 3179.91 3179.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.45 81.68% 3151.80 2784 3396 3161.21 2784 3382 54994 78620 30.05
crit 3.91 18.32% 6313.63 5567 6791 6092.23 0 6791 24707 35322 28.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 1564 0.8% 21.4 1.44sec 1843 1486 Direct 21.4 1576 3152 1843 16.9%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.36 21.36 0.00 0.00 1.2406 0.0000 39373.37 56288.95 30.05 1485.79 1485.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.75 83.07% 1576.41 1392 1698 1580.90 1392 1691 27974 39993 30.05
crit 3.62 16.93% 3152.20 2784 3396 3026.78 0 3396 11399 16296 28.77
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
DL_GF_Felguard
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_GF_Felguard
  • harmful:false
  • if_expr:
 
Berserking 2.0 187.28sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:pet.demonic_tyrant.active|target.time_to_die<=15
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Call Dreadstalkers 14.6 20.93sec

Stats details: call_dreadstalkers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.60 0.00 0.00 0.00 1.2018 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: call_dreadstalkers

Static Values
  • id:104316
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:20.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
Spelldata
  • id:104316
  • name:Call Dreadstalkers
  • school:shadow
  • tooltip:
  • description:Summons {$s1=2} ferocious Dreadstalkers to attack the target for {$193332d=12 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_GF_Felguard
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_GF_Felguard
  • harmful:false
  • if_expr:
 
Grimoire: Felguard 3.0 120.76sec

Stats details: grimoire_felguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 1.1285 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: grimoire_felguard

Static Values
  • id:111898
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
Spelldata
  • id:111898
  • name:Grimoire: Felguard
  • school:shadow
  • tooltip:
  • description:Summons a Felguard who attacks the target for {$s1=15} sec that deals {$216187s1=25}% increased damage. This Felguard will stun their target when summoned.
 
Nether Portal 2.0 0.00sec

Stats details: nether_portal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.2383 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: nether_portal

Static Values
  • id:267217
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Spelldata
  • id:267217
  • name:Nether Portal
  • school:shadow
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Summon Demonic Tyrant 3.6 93.54sec

Stats details: summon_demonic_tyrant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.61 0.00 0.00 0.00 1.5122 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_demonic_tyrant

Static Values
  • id:265187
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
Spelldata
  • id:265187
  • name:Summon Demonic Tyrant
  • school:shadow
  • tooltip:
  • description:Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.
 
Summon Felguard 1.0 0.00sec

Stats details: summon_felguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_felguard

Static Values
  • id:30146
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:30146
  • name:Summon Felguard
  • school:shadow
  • tooltip:
  • description:Summons a Felguard under your command as a powerful melee combatant.
 
summon_random_demon 15.1 14.69sec

Stats details: summon_random_demon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.14 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_random_demon

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
 
Summon Vilefiend 6.8 47.23sec

Stats details: summon_vilefiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.78 0.00 0.00 0.00 1.5398 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_vilefiend

Static Values
  • id:264119
  • school:fire
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Spelldata
  • id:264119
  • name:Summon Vilefiend
  • school:fire
  • tooltip:
  • description:Summon a Vilefiend to fight for you for the next {$d=15 seconds}.
 
pet - grimoire_felguard
Axe Toss 4.0 80.23sec

Stats details: axe_toss

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.98 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: axe_toss

Static Values
  • id:89766
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89766
  • name:Axe Toss
  • school:physical
  • tooltip:Stunned for {$d=4 seconds}.
  • description:The $?s108499[Wrathguard][Felguard] hurls its weapon, stunning the target for {$89766d=4 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:28.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=7}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 100.0sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 187.2sec 187.2sec 6.76% 8.17% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Demonic Calling 12.8 15.4 23.2sec 10.2sec 51.83% 83.78% 15.4(15.4) 0.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_calling_1:51.83%

Trigger Attempt Success

  • trigger_pct:20.04%

Spelldata details

  • id:205146
  • name:Demonic Calling
  • tooltip:Your next Call Dreadstalkers costs {$205145s1=1} less Soul Shard and has no cast time.
  • description:{$@spelldesc205145=Shadow Bolt{$?s264178=true}[ and Demonbolt have][ has] a {$h=20}% chance to make your next Call Dreadstalkers cost {$s1=1} less Soul Shard and have no cast time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Demonic Core 23.5 30.0 12.3sec 5.3sec 38.57% 100.00% 4.4(4.4) 0.4

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_demonic_core
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_core_1:15.81%
  • demonic_core_2:15.67%
  • demonic_core_3:5.01%
  • demonic_core_4:2.09%

Trigger Attempt Success

  • trigger_pct:25.75%

Spelldata details

  • id:264173
  • name:Demonic Core
  • tooltip:The cast time of Demonbolt is reduced by {$s1=100}%.
  • description:{$@spelldesc267102=When your Wild Imps expend all of their energy or are imploded, you have a {$s1=10}% chance to absorb their life essence, granting you a stack of Demonic Core. When your summoned Dreadstalkers fade away, you have a {$s2=100}% chance to absorb their life essence, granting you a stack of Demonic Core. Demonic Core reduces the cast time of Demonbolt by {$264173s1=100}%. Maximum {$264173u=4} stacks.}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Demonic Power 3.6 0.0 93.5sec 93.5sec 17.70% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_demonic_power
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_power_1:17.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:265273
  • name:Demonic Power
  • tooltip:Damage dealt by your demons increased by {$s2=15}%.
  • description:{$@spelldesc265187=Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
dreadstalkers 11.6 17.6 26.6sec 10.1sec 66.09% 0.00% 0.0(0.0) 10.9

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_dreadstalkers
  • max_stacks:4
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • dreadstalkers_2:59.66%
  • dreadstalkers_4:6.43%

Trigger Attempt Success

  • trigger_pct:100.00%
eyes_of_guldan 0.1 0.5 183.2sec 2.1sec 1.20% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_eyes_of_guldan
  • max_stacks:4
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • eyes_of_guldan_4:1.20%

Trigger Attempt Success

  • trigger_pct:100.00%
grimoire_felguard 3.0 0.0 120.7sec 120.7sec 19.75% 0.00% 0.0(0.0) 2.9

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_grimoire_felguard
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • grimoire_felguard_1:19.75%

Trigger Attempt Success

  • trigger_pct:100.00%
Ignition Mage's Fuse 2.4 0.0 171.7sec 171.7sec 14.87% 0.00% 2.0(2.0) 2.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:275.80

Stack Uptimes

  • ignition_mages_fuse_1:3.13%
  • ignition_mages_fuse_2:3.09%
  • ignition_mages_fuse_3:3.05%
  • ignition_mages_fuse_4:2.89%
  • ignition_mages_fuse_5:2.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Nether Portal 2.0 0.0 182.8sec 0.0sec 10.14% 18.26% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_nether_portal
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • nether_portal_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267217
  • name:Nether Portal
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Overwhelming Power 4.3 2.9 66.8sec 36.8sec 43.76% 0.00% 2.9(40.5) 0.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • overwhelming_power_1:1.30%
  • overwhelming_power_2:1.33%
  • overwhelming_power_3:1.36%
  • overwhelming_power_4:1.40%
  • overwhelming_power_5:1.44%
  • overwhelming_power_6:1.47%
  • overwhelming_power_7:1.51%
  • overwhelming_power_8:1.55%
  • overwhelming_power_9:1.59%
  • overwhelming_power_10:1.63%
  • overwhelming_power_11:1.67%
  • overwhelming_power_12:1.71%
  • overwhelming_power_13:1.76%
  • overwhelming_power_14:1.80%
  • overwhelming_power_15:1.85%
  • overwhelming_power_16:1.90%
  • overwhelming_power_17:1.95%
  • overwhelming_power_18:2.01%
  • overwhelming_power_19:2.07%
  • overwhelming_power_20:2.13%
  • overwhelming_power_21:2.19%
  • overwhelming_power_22:2.25%
  • overwhelming_power_23:2.32%
  • overwhelming_power_24:2.38%
  • overwhelming_power_25:1.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
portal_summons 2.0 13.1 182.8sec 14.7sec 19.61% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_portal_summons
  • max_stacks:40
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • portal_summons_1:2.02%
  • portal_summons_2:0.75%
  • portal_summons_3:1.26%
  • portal_summons_4:1.95%
  • portal_summons_5:1.39%
  • portal_summons_6:1.76%
  • portal_summons_7:4.34%
  • portal_summons_8:6.10%
  • portal_summons_9:0.05%

Trigger Attempt Success

  • trigger_pct:100.00%
prince_malchezaar 0.2 0.0 181.4sec 104.4sec 1.24% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_prince_malchezaar
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • prince_malchezaar_1:1.24%

Trigger Attempt Success

  • trigger_pct:100.00%
Quick Navigation 6.0 22.4 52.2sec 10.3sec 67.42% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:17.77%
  • quick_navigation_2:17.15%
  • quick_navigation_3:16.56%
  • quick_navigation_4:15.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.4 0.0 52.2sec 52.2sec 17.51% 0.00% 0.0(0.0) 5.2

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:17.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Supreme Commander 4.4 0.1 82.6sec 79.9sec 17.08% 0.00% 0.1(0.1) 3.4

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_supreme_commander
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:838.00

Stack Uptimes

  • supreme_commander_1:17.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279878
  • name:Supreme Commander
  • tooltip:
  • description:When your Demonic Tyrant expires, consume its life essence, granting you a stack of Demonic Core and increasing your Intellect by {$s1=398} for {$279885d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tyrant 3.6 0.0 93.5sec 93.5sec 17.70% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_tyrant
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • tyrant_1:17.70%

Trigger Attempt Success

  • trigger_pct:100.00%
vilefiend 6.8 0.0 47.2sec 47.2sec 47.40% 0.00% 0.0(0.0) 6.4

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_vilefiend
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vilefiend_1:47.40%

Trigger Attempt Success

  • trigger_pct:100.00%
wild_imps 5.2 153.7 55.8sec 0.0sec 96.13% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_wild_imps
  • max_stacks:40
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • wild_imps_1:2.29%
  • wild_imps_2:2.74%
  • wild_imps_3:28.81%
  • wild_imps_4:7.65%
  • wild_imps_5:9.47%
  • wild_imps_6:26.10%
  • wild_imps_7:5.87%
  • wild_imps_8:3.97%
  • wild_imps_9:4.79%
  • wild_imps_10:1.54%
  • wild_imps_11:1.15%
  • wild_imps_12:1.10%
  • wild_imps_13:0.42%
  • wild_imps_14:0.18%
  • wild_imps_15:0.05%
  • wild_imps_16:0.01%
  • wild_imps_17:0.00%
  • wild_imps_18:0.00%
grimoire_felguard: Grimoire of Service 3.0 0.0 120.7sec 120.7sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_GF_Felguard_grimoire_felguard
  • cooldown name:buff_grimoire_of_service
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • grimoire_of_service_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216187
  • name:Grimoire of Service
  • tooltip:Summoned by a Grimoire of Service. Damage done increased by {$s1=25}%.
  • description:{$@spelldesc108501=Summons a second demon which fights for you for {$s1=25} sec and deals {$216187s1=25}% increased damage. 1.5 min cooldown. The demon will immmediately use one of its special abilities when summoned: $@spellname111859: Cleanses 1 harmful Magic effect from you. $@spellname111895 Taunts its target. $@spellname111896 Seduces its target. $@spellname111897 Interrupts its target.$?c2[ $@spellname111898 Stuns its target.][]}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
summon_random_demon 15.1 13.9sec
one_shard_hog 8.8 21.7sec
two_shard_hog 3.8 17.1sec
three_shard_hog 47.8 5.8sec
portal_summon 15.1 13.9sec

Resources

Resource Usage Type Count Total Average RPE APR
DL_GF_Felguard
call_dreadstalkers Soul Shard 14.6 17.0 1.2 1.2 0.0
demonbolt Mana 45.2 90405.0 2000.0 2045.2 4.2
grimoire_felguard Soul Shard 3.0 3.0 1.0 1.0 0.0
hand_of_guldan Soul Shard 60.4 159.7 2.6 2.6 1976.0
shadow_bolt Mana 95.7 191315.2 2000.0 2000.0 2.1
summon_demonic_tyrant Mana 3.6 7211.7 2000.0 2000.2 0.0
summon_vilefiend Soul Shard 6.8 6.8 1.0 1.0 0.0
pet - felguard
felstorm Energy 10.4 624.6 60.0 60.0 181.8
legion_strike Energy 58.4 3503.4 60.0 60.0 90.8
pet - grimoire_felguard
felstorm Energy 3.9 236.4 60.0 60.0 193.0
legion_strike Energy 18.4 1105.5 60.0 60.0 116.8
pet - wild_imp
fel_firebolt Energy 995.8 15591.6 15.7 15.7 47.7
Resource Gains Type Count Total Average Overflow
demonbolt Soul Shard 45.20 90.39 (48.58%) 2.00 0.01 0.02%
shadow_bolt Soul Shard 95.66 95.66 (51.42%) 1.00 0.00 0.00%
mana_regen Mana 553.64 286228.51 (100.00%) 517.00 13214.89 4.41%
pet - felguard
energy_regen Energy 375.11 3988.07 (100.00%) 10.63 18.58 0.46%
pet - grimoire_felguard
energy_regen Energy 91.47 913.36 (100.00%) 9.99 48.40 5.03%
pet - demonic_tyrant
energy_regen Energy 37.75 0.00 (0.00%) 0.00 762.08 100.00%
pet - bilescourge
energy_regen Energy 9.57 0.00 (0.00%) 0.00 133.66 100.00%
pet - bilescourge
energy_regen Energy 12.18 0.00 (0.00%) 0.00 168.11 100.00%
pet - bilescourge
energy_regen Energy 15.26 0.00 (0.00%) 0.00 212.01 100.00%
pet - bilescourge
energy_regen Energy 7.81 0.00 (0.00%) 0.00 108.91 100.00%
pet - bilescourge
energy_regen Energy 6.67 0.00 (0.00%) 0.00 92.89 100.00%
Resource RPS-Gain RPS-Loss
Mana 954.14 963.15
Soul Shard 0.62 0.62
Combat End Resource Mean Min Max
Mana 97264.18 92697.00 100000.00
Soul Shard 2.59 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.7%

Statistics & Data Analysis

Fight Length
Sample Data DL_GF_Felguard Fight Length
Count 4999
Mean 299.99
Minimum 240.01
Maximum 359.96
Spread ( max - min ) 119.95
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data DL_GF_Felguard Damage Per Second
Count 4999
Mean 16684.77
Minimum 14875.53
Maximum 18791.08
Spread ( max - min ) 3915.54
Range [ ( max - min ) / 2 * 100% ] 11.73%
Standard Deviation 560.7783
5th Percentile 15824.53
95th Percentile 17671.24
( 95th Percentile - 5th Percentile ) 1846.71
Mean Distribution
Standard Deviation 7.9314
95.00% Confidence Intervall ( 16669.23 - 16700.32 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4340
0.1 Scale Factor Error with Delta=300 2685
0.05 Scale Factor Error with Delta=300 10739
0.01 Scale Factor Error with Delta=300 268452
Priority Target DPS
Sample Data DL_GF_Felguard Priority Target Damage Per Second
Count 4999
Mean 16684.77
Minimum 14875.53
Maximum 18791.08
Spread ( max - min ) 3915.54
Range [ ( max - min ) / 2 * 100% ] 11.73%
Standard Deviation 560.7783
5th Percentile 15824.53
95th Percentile 17671.24
( 95th Percentile - 5th Percentile ) 1846.71
Mean Distribution
Standard Deviation 7.9314
95.00% Confidence Intervall ( 16669.23 - 16700.32 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4340
0.1 Scale Factor Error with Delta=300 2685
0.05 Scale Factor Error with Delta=300 10739
0.01 Scale Factor Error with Delta=300 268452
DPS(e)
Sample Data DL_GF_Felguard Damage Per Second (Effective)
Count 4999
Mean 16684.77
Minimum 14875.53
Maximum 18791.08
Spread ( max - min ) 3915.54
Range [ ( max - min ) / 2 * 100% ] 11.73%
Damage
Sample Data DL_GF_Felguard Damage
Count 4999
Mean 1239961.20
Minimum 884326.54
Maximum 1651399.11
Spread ( max - min ) 767072.57
Range [ ( max - min ) / 2 * 100% ] 30.93%
DTPS
Sample Data DL_GF_Felguard Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data DL_GF_Felguard Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data DL_GF_Felguard Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data DL_GF_Felguard Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data DL_GF_Felguard Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data DL_GF_Felguard Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data DL_GF_FelguardTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data DL_GF_Felguard Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 inner_demons,if=talent.inner_demons.enabled
5 0.00 snapshot_stats
6 0.00 potion
7 0.00 demonbolt
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,if=pet.demonic_tyrant.active|target.time_to_die<30
9 2.38 use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
A 2.00 berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
0.00 demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
B 0.00 call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
C 0.00 call_action_list,name=implosion,if=spell_targets.implosion>1
D 1.98 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
E 4.81 summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
F 11.59 call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
G 1.63 summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
0.00 doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
H 44.50 hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
0.00 soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
I 40.45 demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
0.00 bilescourge_bombers
J 0.00 call_action_list,name=build_a_shard
actions.build_a_shard
# count action,conditions
0.00 demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
0.00 soul_strike
K 96.18 shadow_bolt
actions.nether_portal_active
# count action,conditions
O 1.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
P 2.00 summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Q 2.00 call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
R 0.00 call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
S 13.67 hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
T 1.95 summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
U 0.04 summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
V 3.75 demonbolt,if=buff.demonic_core.up
W 0.00 call_action_list,name=build_a_shard
actions.nether_portal_building
# count action,conditions
X 2.00 nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Y 1.02 call_dreadstalkers
Z 0.54 hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
a 1.91 hand_of_guldan,if=soul_shard>=5
b 0.00 call_action_list,name=build_a_shard

Sample Sequence

012367XOPQST9AKSKSKSKSKSKSKSKKKIHKFKHIIHKIHIHIIHIHIKIHIFHKEIKHKIHIIKHFKKHKKKHKKKIHKKKFHIIHEG8IHKKKKKFHKIHIIHIDKHIIKHFKKHKKKIHEIHIIKHFKKHKKKKKaKKKYZKKKKXSSVSVST9AVPQVSVSKSKKKHIIHIKKFHKKHKKKHIIHKKFKKKEHDIIHIHIKFKHKKKHKKKHKIIFHKKHKGKKEKHKKFKKHIK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask DL_GF_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food DL_GF_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 augmentation DL_GF_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_felguard Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 potion Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard battle_potion_of_intellect
0:00.000 precombat 7 demonbolt Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard demonic_calling, battle_potion_of_intellect
0:00.000 nether_portal_building X nether_portal Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard demonic_calling, archive_of_the_titans, battle_potion_of_intellect
0:01.276 nether_portal_active O grimoire_felguard Fluffy_Pillow 99276.0/100000: 99% mana | 5.0/5: 100% soul_shard bloodlust, demonic_calling, nether_portal, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:02.257 nether_portal_active P summon_vilefiend Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, demonic_calling, nether_portal, grimoire_felguard, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:03.566 nether_portal_active Q call_dreadstalkers Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, nether_portal, vilefiend, grimoire_felguard, portal_summons(2), overwhelming_power(25), archive_of_the_titans, battle_potion_of_intellect
0:04.418 nether_portal_active S hand_of_guldan Fluffy_Pillow 100000.0/100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(3), overwhelming_power(24), archive_of_the_titans, battle_potion_of_intellect
0:05.273 nether_portal_active T summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(4), quick_navigation, overwhelming_power(23), archive_of_the_titans(2), battle_potion_of_intellect
0:06.414 default 9 use_items Fluffy_Pillow 98006.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), quick_navigation, overwhelming_power(22), archive_of_the_titans(2), battle_potion_of_intellect
0:06.414 default A berserking Fluffy_Pillow 98006.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), quick_navigation, overwhelming_power(22), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:06.414 build_a_shard K shadow_bolt Fluffy_Pillow 98006.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), quick_navigation, overwhelming_power(22), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.381 nether_portal_active S hand_of_guldan Fluffy_Pillow 96973.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), quick_navigation, overwhelming_power(21), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.135 build_a_shard K shadow_bolt Fluffy_Pillow 97727.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(5), quick_navigation, overwhelming_power(20), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.112 nether_portal_active S hand_of_guldan Fluffy_Pillow 96704.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(5), quick_navigation, overwhelming_power(19), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.865 build_a_shard K shadow_bolt Fluffy_Pillow 97457.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(6), quick_navigation, overwhelming_power(19), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:10.846 nether_portal_active S hand_of_guldan Fluffy_Pillow 96438.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(6), quick_navigation, overwhelming_power(18), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.598 build_a_shard K shadow_bolt Fluffy_Pillow 97190.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(7), quick_navigation, overwhelming_power(17), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.565 nether_portal_active S hand_of_guldan Fluffy_Pillow 96157.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(7), quick_navigation, overwhelming_power(16), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.319 build_a_shard K shadow_bolt Fluffy_Pillow 96911.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation, overwhelming_power(15), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.294 nether_portal_active S hand_of_guldan Fluffy_Pillow 95886.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation, overwhelming_power(14), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.049 build_a_shard K shadow_bolt Fluffy_Pillow 96641.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation, overwhelming_power(13), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.007 nether_portal_active S hand_of_guldan Fluffy_Pillow 95599.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation, overwhelming_power(12), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.761 build_a_shard K shadow_bolt Fluffy_Pillow 96353.0/100000: 96% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation, overwhelming_power(25), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.796 nether_portal_active S hand_of_guldan Fluffy_Pillow 95388.0/100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(2), overwhelming_power(24), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.573 build_a_shard K shadow_bolt Fluffy_Pillow 96165.0/100000: 96% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(2), overwhelming_power(23), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.586 build_a_shard K shadow_bolt Fluffy_Pillow 95178.0/100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(2), overwhelming_power(22), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.605 build_a_shard K shadow_bolt Fluffy_Pillow 94197.0/100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(2), overwhelming_power(21), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.629 default I demonbolt Fluffy_Pillow 93221.0/100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(9), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(2), overwhelming_power(20), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.401 default H hand_of_guldan Fluffy_Pillow 91993.0/100000: 92% mana | 5.0/5: 100% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(9), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(2), overwhelming_power(19), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:23.177 build_a_shard K shadow_bolt Fluffy_Pillow 92769.0/100000: 93% mana | 2.0/5: 40% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(9), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(2), overwhelming_power(18), archive_of_the_titans(5), ignition_mages_fuse(5)
0:24.186 default F call_dreadstalkers Fluffy_Pillow 91778.0/100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(9), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(2), overwhelming_power(17), archive_of_the_titans(5), ignition_mages_fuse(5)
0:24.947 build_a_shard K shadow_bolt Fluffy_Pillow 92539.0/100000: 93% mana | 2.0/5: 40% soul_shard bloodlust, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(2), overwhelming_power(17), archive_of_the_titans(5), ignition_mages_fuse(5)
0:25.962 default H hand_of_guldan Fluffy_Pillow 91554.0/100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(8), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(2), overwhelming_power(16), archive_of_the_titans(6), ignition_mages_fuse(5)
0:26.728 default I demonbolt Fluffy_Pillow 92320.0/100000: 92% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(2), supreme_commander, wild_imps(3), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(2), overwhelming_power(15), archive_of_the_titans(6)
0:27.617 default I demonbolt Fluffy_Pillow 91209.0/100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(3), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(2), overwhelming_power(14), archive_of_the_titans(6)
0:28.511 default H hand_of_guldan Fluffy_Pillow 90103.0/100000: 90% mana | 4.0/5: 80% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(5), dreadstalkers(4), vilefiend, grimoire_felguard, quick_navigation(2), overwhelming_power(13), archive_of_the_titans(6)
0:29.409 build_a_shard K shadow_bolt Fluffy_Pillow 91001.0/100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(4), vilefiend, grimoire_felguard, quick_navigation(2), overwhelming_power(12), archive_of_the_titans(6)
0:30.613 default I demonbolt Fluffy_Pillow 90205.0/100000: 90% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core(3), demonic_calling, supreme_commander, wild_imps(5), dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation(3), overwhelming_power(11), archive_of_the_titans(7)
0:31.518 default H hand_of_guldan Fluffy_Pillow 89110.0/100000: 89% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power(10), archive_of_the_titans(7)
0:32.427 default I demonbolt Fluffy_Pillow 90019.0/100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power(9), archive_of_the_titans(7)
0:33.342 default H hand_of_guldan Fluffy_Pillow 88934.0/100000: 89% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power(8), archive_of_the_titans(7)
0:34.259 default I demonbolt Fluffy_Pillow 89851.0/100000: 90% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), quick_navigation(4), overwhelming_power(7), archive_of_the_titans(7)
0:35.177 default I demonbolt Fluffy_Pillow 88769.0/100000: 89% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation(4), overwhelming_power(6), archive_of_the_titans(8)
0:36.104 default H hand_of_guldan Fluffy_Pillow 87696.0/100000: 88% mana | 4.0/5: 80% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(8), dreadstalkers(2), quick_navigation_final, overwhelming_power(5), archive_of_the_titans(8)
0:36.995 default I demonbolt Fluffy_Pillow 88587.0/100000: 89% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core(2), demonic_calling, wild_imps(7), quick_navigation_final, overwhelming_power(5), archive_of_the_titans(8)
0:37.883 default H hand_of_guldan Fluffy_Pillow 87475.0/100000: 87% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core, demonic_calling, wild_imps(6), quick_navigation_final, overwhelming_power(4), archive_of_the_titans(8)
0:38.778 default I demonbolt Fluffy_Pillow 88370.0/100000: 88% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core, demonic_calling, wild_imps(8), quick_navigation_final, overwhelming_power(3), archive_of_the_titans(8)
0:39.676 build_a_shard K shadow_bolt Fluffy_Pillow 87268.0/100000: 87% mana | 2.0/5: 40% soul_shard bloodlust, demonic_calling, wild_imps(8), quick_navigation_final, overwhelming_power(2), archive_of_the_titans(8)
0:40.880 default I demonbolt Fluffy_Pillow 86472.0/100000: 86% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core(2), demonic_calling, wild_imps(9), quick_navigation_final, overwhelming_power, archive_of_the_titans(9)
0:41.791 default H hand_of_guldan Fluffy_Pillow 85383.0/100000: 85% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(7), quick_navigation_final, archive_of_the_titans(9)
0:42.980 default I demonbolt Fluffy_Pillow 86572.0/100000: 87% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(6), quick_navigation_final, archive_of_the_titans(9)
0:44.169 default F call_dreadstalkers Fluffy_Pillow 85761.0/100000: 86% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), quick_navigation_final, archive_of_the_titans(9)
0:45.373 default H hand_of_guldan Fluffy_Pillow 86965.0/100000: 87% mana | 3.0/5: 60% soul_shard wild_imps(7), dreadstalkers(2), archive_of_the_titans(10)
0:46.651 build_a_shard K shadow_bolt Fluffy_Pillow 88243.0/100000: 88% mana | 0.0/5: 0% soul_shard wild_imps(6), dreadstalkers(2), archive_of_the_titans(10)
0:48.352 default E summon_vilefiend Fluffy_Pillow 87944.0/100000: 88% mana | 1.0/5: 20% soul_shard wild_imps(6), dreadstalkers(2), archive_of_the_titans(10)
0:50.259 default I demonbolt Fluffy_Pillow 89851.0/100000: 90% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(6), dreadstalkers(2), vilefiend, archive_of_the_titans(11)
0:51.535 build_a_shard K shadow_bolt Fluffy_Pillow 89127.0/100000: 89% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, archive_of_the_titans(11)
0:53.236 default H hand_of_guldan Fluffy_Pillow 88828.0/100000: 89% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, archive_of_the_titans(11)
0:54.513 build_a_shard K shadow_bolt Fluffy_Pillow 90105.0/100000: 90% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(11)
0:56.203 default I demonbolt Fluffy_Pillow 89795.0/100000: 90% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(5), vilefiend, quick_navigation, archive_of_the_titans(12)
0:57.471 default H hand_of_guldan Fluffy_Pillow 89063.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), vilefiend, quick_navigation, archive_of_the_titans(12)
0:58.741 default I demonbolt Fluffy_Pillow 90333.0/100000: 90% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(3), vilefiend, quick_navigation, archive_of_the_titans(12)
1:00.010 default I demonbolt Fluffy_Pillow 89602.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(4), vilefiend, quick_navigation, archive_of_the_titans(13)
1:01.277 build_a_shard K shadow_bolt Fluffy_Pillow 88869.0/100000: 89% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation(2), archive_of_the_titans(13)
1:02.957 default H hand_of_guldan Fluffy_Pillow 88549.0/100000: 89% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation(2), archive_of_the_titans(13)
1:04.218 default F call_dreadstalkers Fluffy_Pillow 89810.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(5), vilefiend, quick_navigation(2), archive_of_the_titans(13)
1:05.477 build_a_shard K shadow_bolt Fluffy_Pillow 91069.0/100000: 91% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(14)
1:07.157 build_a_shard K shadow_bolt Fluffy_Pillow 90749.0/100000: 91% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(14)
1:08.826 default H hand_of_guldan Fluffy_Pillow 90418.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(14)
1:10.079 build_a_shard K shadow_bolt Fluffy_Pillow 91671.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(15)
1:11.748 build_a_shard K shadow_bolt Fluffy_Pillow 91340.0/100000: 91% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(15)
1:13.418 build_a_shard K shadow_bolt Fluffy_Pillow 91010.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(15)
1:15.088 default H hand_of_guldan Fluffy_Pillow 90680.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(16)
1:16.333 build_a_shard K shadow_bolt Fluffy_Pillow 91925.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(4), archive_of_the_titans(16)
1:17.992 build_a_shard K shadow_bolt Fluffy_Pillow 91584.0/100000: 92% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation(4), archive_of_the_titans(16)
1:19.651 build_a_shard K shadow_bolt Fluffy_Pillow 91243.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation(4), archive_of_the_titans(16)
1:21.312 default I demonbolt Fluffy_Pillow 90904.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_core(3), demonic_calling, wild_imps(3), quick_navigation(4), archive_of_the_titans(17)
1:22.558 default H hand_of_guldan Fluffy_Pillow 90150.0/100000: 90% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(4), archive_of_the_titans(17)
1:23.803 build_a_shard K shadow_bolt Fluffy_Pillow 91395.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(4), archive_of_the_titans(17)
1:25.463 build_a_shard K shadow_bolt Fluffy_Pillow 91055.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation(4), archive_of_the_titans(18)
1:27.124 build_a_shard K shadow_bolt Fluffy_Pillow 90716.0/100000: 91% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(4), archive_of_the_titans(18)
1:28.785 default F call_dreadstalkers Fluffy_Pillow 90377.0/100000: 90% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(4), archive_of_the_titans(18)
1:30.030 default H hand_of_guldan Fluffy_Pillow 91622.0/100000: 92% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(19)
1:31.275 default I demonbolt Fluffy_Pillow 92867.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(19)
1:32.520 default I demonbolt Fluffy_Pillow 92112.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(19)
1:33.764 default H hand_of_guldan Fluffy_Pillow 91356.0/100000: 91% mana | 5.0/5: 100% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(19)
1:35.007 default E summon_vilefiend Fluffy_Pillow 92599.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
1:36.840 default G summon_demonic_tyrant Fluffy_Pillow 94432.0/100000: 94% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
1:38.423 default 8 potion Fluffy_Pillow 94015.0/100000: 94% mana | 1.0/5: 20% soul_shard demonic_core, demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20)
1:38.423 default I demonbolt Fluffy_Pillow 94015.0/100000: 94% mana | 1.0/5: 20% soul_shard demonic_core, demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:39.612 default H hand_of_guldan Fluffy_Pillow 93204.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:40.802 build_a_shard K shadow_bolt Fluffy_Pillow 94394.0/100000: 94% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:42.384 build_a_shard K shadow_bolt Fluffy_Pillow 93976.0/100000: 94% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:43.967 build_a_shard K shadow_bolt Fluffy_Pillow 93559.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:45.549 build_a_shard K shadow_bolt Fluffy_Pillow 93141.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, archive_of_the_titans(20), battle_potion_of_intellect
1:47.251 build_a_shard K shadow_bolt Fluffy_Pillow 92843.0/100000: 93% mana | 4.0/5: 80% soul_shard demonic_power, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, archive_of_the_titans(20), battle_potion_of_intellect
1:48.950 default F call_dreadstalkers Fluffy_Pillow 92542.0/100000: 93% mana | 5.0/5: 100% soul_shard demonic_power, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, archive_of_the_titans(20), battle_potion_of_intellect
1:50.650 default H hand_of_guldan Fluffy_Pillow 94242.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(9), dreadstalkers(4), vilefiend, tyrant, quick_navigation, archive_of_the_titans(20), battle_potion_of_intellect
1:51.920 build_a_shard K shadow_bolt Fluffy_Pillow 95512.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(9), dreadstalkers(4), vilefiend, tyrant, quick_navigation, archive_of_the_titans(20), battle_potion_of_intellect
1:53.609 default I demonbolt Fluffy_Pillow 95201.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_core, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, quick_navigation, archive_of_the_titans(20), battle_potion_of_intellect
1:54.878 default H hand_of_guldan Fluffy_Pillow 94470.0/100000: 94% mana | 3.0/5: 60% soul_shard supreme_commander, wild_imps(12), dreadstalkers(4), vilefiend, quick_navigation, archive_of_the_titans(20), battle_potion_of_intellect
1:56.147 default I demonbolt Fluffy_Pillow 95739.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_core(2), supreme_commander, wild_imps(9), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(20), battle_potion_of_intellect
1:57.416 default I demonbolt Fluffy_Pillow 95008.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core, supreme_commander, wild_imps(10), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(20), battle_potion_of_intellect
1:58.685 default H hand_of_guldan Fluffy_Pillow 94277.0/100000: 94% mana | 4.0/5: 80% soul_shard supreme_commander, wild_imps(12), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(20), battle_potion_of_intellect
1:59.954 default I demonbolt Fluffy_Pillow 95546.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_core, supreme_commander, wild_imps(9), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(20), battle_potion_of_intellect
2:01.223 default D grimoire_felguard Fluffy_Pillow 94815.0/100000: 95% mana | 3.0/5: 60% soul_shard supreme_commander, wild_imps(8), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(20), battle_potion_of_intellect
2:02.544 build_a_shard K shadow_bolt Fluffy_Pillow 96136.0/100000: 96% mana | 2.0/5: 40% soul_shard supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation, archive_of_the_titans(20), battle_potion_of_intellect
2:04.233 default H hand_of_guldan Fluffy_Pillow 95825.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core(2), supreme_commander, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation(2), archive_of_the_titans(20)
2:05.494 default I demonbolt Fluffy_Pillow 97086.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core(2), supreme_commander, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation(2), archive_of_the_titans(20)
2:06.755 default I demonbolt Fluffy_Pillow 96347.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core, supreme_commander, wild_imps(4), vilefiend, grimoire_felguard, quick_navigation(2), archive_of_the_titans(20)
2:08.018 build_a_shard K shadow_bolt Fluffy_Pillow 95610.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_calling, supreme_commander, wild_imps(6), grimoire_felguard, quick_navigation(2), archive_of_the_titans(20)
2:09.696 default H hand_of_guldan Fluffy_Pillow 95288.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(5), grimoire_felguard, quick_navigation(3), archive_of_the_titans(20)
2:10.949 default F call_dreadstalkers Fluffy_Pillow 96541.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(3), grimoire_felguard, quick_navigation(4), overwhelming_power(25), archive_of_the_titans(20)
2:12.032 build_a_shard K shadow_bolt Fluffy_Pillow 97624.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(3), dreadstalkers(2), grimoire_felguard, quick_navigation(4), overwhelming_power(23), archive_of_the_titans(20)
2:13.487 build_a_shard K shadow_bolt Fluffy_Pillow 97079.0/100000: 97% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), grimoire_felguard, quick_navigation(4), overwhelming_power(22), archive_of_the_titans(20)
2:14.951 default H hand_of_guldan Fluffy_Pillow 96543.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), grimoire_felguard, quick_navigation_final, overwhelming_power(21), archive_of_the_titans(20)
2:16.012 build_a_shard K shadow_bolt Fluffy_Pillow 97604.0/100000: 98% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), grimoire_felguard, quick_navigation_final, overwhelming_power(19), archive_of_the_titans(20)
2:17.438 build_a_shard K shadow_bolt Fluffy_Pillow 97030.0/100000: 97% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(18), archive_of_the_titans(20)
2:18.873 build_a_shard K shadow_bolt Fluffy_Pillow 96465.0/100000: 96% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(17), archive_of_the_titans(20)
2:20.313 default I demonbolt Fluffy_Pillow 95905.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation_final, overwhelming_power(15), archive_of_the_titans(20)
2:21.406 default H hand_of_guldan Fluffy_Pillow 94998.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation_final, overwhelming_power(14), archive_of_the_titans(20)
2:22.504 default E summon_vilefiend Fluffy_Pillow 96096.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation_final, overwhelming_power(13), archive_of_the_titans(20)
2:23.975 default I demonbolt Fluffy_Pillow 97567.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(4), vilefiend, quick_navigation_final, overwhelming_power(12), archive_of_the_titans(20)
2:25.086 default H hand_of_guldan Fluffy_Pillow 96678.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(4), vilefiend, overwhelming_power(10), archive_of_the_titans(20)
2:26.287 default I demonbolt Fluffy_Pillow 97879.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(3), vilefiend, quick_navigation, overwhelming_power(9), archive_of_the_titans(20)
2:27.489 default I demonbolt Fluffy_Pillow 97081.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(4), vilefiend, quick_navigation, overwhelming_power(8), archive_of_the_titans(20)
2:28.697 build_a_shard K shadow_bolt Fluffy_Pillow 96289.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation, overwhelming_power(7), archive_of_the_titans(20)
2:30.316 default H hand_of_guldan Fluffy_Pillow 95908.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation, overwhelming_power(5), archive_of_the_titans(20)
2:31.546 default F call_dreadstalkers Fluffy_Pillow 97138.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(5), vilefiend, quick_navigation(2), overwhelming_power(4), archive_of_the_titans(20)
2:32.777 build_a_shard K shadow_bolt Fluffy_Pillow 98369.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(3), archive_of_the_titans(20)
2:34.426 build_a_shard K shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power, archive_of_the_titans(20)
2:36.097 default H hand_of_guldan Fluffy_Pillow 97675.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:37.358 build_a_shard K shadow_bolt Fluffy_Pillow 98936.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:39.039 build_a_shard K shadow_bolt Fluffy_Pillow 98006.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:40.718 build_a_shard K shadow_bolt Fluffy_Pillow 97685.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:42.396 build_a_shard K shadow_bolt Fluffy_Pillow 97363.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:44.076 build_a_shard K shadow_bolt Fluffy_Pillow 97043.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(2), archive_of_the_titans(20)
2:45.756 nether_portal_building a hand_of_guldan Fluffy_Pillow 96723.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(2), archive_of_the_titans(20)
2:47.015 build_a_shard K shadow_bolt Fluffy_Pillow 97982.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(2), quick_navigation(3), archive_of_the_titans(20)
2:48.684 build_a_shard K shadow_bolt Fluffy_Pillow 97651.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(2), quick_navigation(3), archive_of_the_titans(20)
2:50.352 build_a_shard K shadow_bolt Fluffy_Pillow 97319.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(4), archive_of_the_titans(20)
2:52.011 nether_portal_building Y call_dreadstalkers Fluffy_Pillow 96978.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(4), archive_of_the_titans(20)
2:53.257 nether_portal_building Z hand_of_guldan Fluffy_Pillow 98224.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
2:54.501 build_a_shard K shadow_bolt Fluffy_Pillow 99468.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
2:56.161 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(5), dreadstalkers(2), quick_navigation(4), overwhelming_power(25), archive_of_the_titans(20)
2:57.603 build_a_shard K shadow_bolt Fluffy_Pillow 97447.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(3), wild_imps(3), dreadstalkers(2), quick_navigation(4), overwhelming_power(24), archive_of_the_titans(20)
2:59.052 build_a_shard K shadow_bolt Fluffy_Pillow 96896.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(3), wild_imps(3), dreadstalkers(2), quick_navigation(4), overwhelming_power(22), archive_of_the_titans(20)
3:00.516 nether_portal_building X nether_portal Fluffy_Pillow 96360.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_core(3), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(4), overwhelming_power(21), archive_of_the_titans(20)
3:01.619 nether_portal_active S hand_of_guldan Fluffy_Pillow 97463.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(3), demonic_calling, nether_portal, wild_imps(3), dreadstalkers(2), portal_summons, quick_navigation(4), overwhelming_power(20), archive_of_the_titans(20)
3:02.728 nether_portal_active S hand_of_guldan Fluffy_Pillow 98572.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, nether_portal, wild_imps(3), dreadstalkers(2), portal_summons(2), quick_navigation(4), overwhelming_power(19), archive_of_the_titans(20)
3:03.843 nether_portal_active V demonbolt Fluffy_Pillow 99687.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(4), demonic_calling, nether_portal, dreadstalkers(2), portal_summons(3), quick_navigation(4), overwhelming_power(18), archive_of_the_titans(20)
3:04.966 nether_portal_active S hand_of_guldan Fluffy_Pillow 98810.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(4), demonic_calling, nether_portal, wild_imps(3), portal_summons(3), quick_navigation(4), overwhelming_power(17), archive_of_the_titans(20)
3:06.095 nether_portal_active V demonbolt Fluffy_Pillow 99939.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(4), demonic_calling, nether_portal, wild_imps(5), portal_summons(4), quick_navigation(4), overwhelming_power(15), archive_of_the_titans(20)
3:07.237 nether_portal_active S hand_of_guldan Fluffy_Pillow 99081.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, nether_portal, wild_imps(6), portal_summons(4), quick_navigation(4), overwhelming_power(14), archive_of_the_titans(20)
3:08.384 nether_portal_active T summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, nether_portal, wild_imps(7), portal_summons(5), quick_navigation_final, overwhelming_power(13), archive_of_the_titans(20)
3:09.888 default 9 use_items Fluffy_Pillow 98003.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_power, demonic_calling, nether_portal, wild_imps(8), tyrant, portal_summons(5), quick_navigation_final, overwhelming_power(12), archive_of_the_titans(20)
3:09.888 default A berserking Fluffy_Pillow 98003.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_power, demonic_calling, nether_portal, wild_imps(8), tyrant, portal_summons(5), quick_navigation_final, overwhelming_power(12), archive_of_the_titans(20), ignition_mages_fuse
3:09.888 nether_portal_active V demonbolt Fluffy_Pillow 98003.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_core(3), demonic_power, demonic_calling, nether_portal, wild_imps(8), tyrant, portal_summons(5), quick_navigation_final, overwhelming_power(12), archive_of_the_titans(20), ignition_mages_fuse
3:10.827 nether_portal_active P summon_vilefiend Fluffy_Pillow 96942.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_core(2), demonic_power, demonic_calling, nether_portal, wild_imps(9), tyrant, portal_summons(5), quick_navigation_final, overwhelming_power(11), archive_of_the_titans(20), ignition_mages_fuse
3:12.083 nether_portal_active Q call_dreadstalkers Fluffy_Pillow 98198.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_core(2), demonic_power, demonic_calling, nether_portal, wild_imps(9), vilefiend, tyrant, portal_summons(6), quick_navigation_final, overwhelming_power(9), archive_of_the_titans(20), ignition_mages_fuse
3:13.036 nether_portal_active V demonbolt Fluffy_Pillow 99151.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_core(2), demonic_power, nether_portal, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation_final, overwhelming_power(8), archive_of_the_titans(20), ignition_mages_fuse
3:13.995 nether_portal_active S hand_of_guldan Fluffy_Pillow 98110.0/100000: 98% mana | 2.0/5: 40% soul_shard berserking, demonic_core, demonic_power, demonic_calling, nether_portal, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation_final, overwhelming_power(8), archive_of_the_titans(20), ignition_mages_fuse(2)
3:14.926 nether_portal_active V demonbolt Fluffy_Pillow 99041.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_core, demonic_power, demonic_calling, nether_portal, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation_final, overwhelming_power(7), archive_of_the_titans(20), ignition_mages_fuse(2)
3:15.862 nether_portal_active S hand_of_guldan Fluffy_Pillow 97977.0/100000: 98% mana | 2.0/5: 40% soul_shard berserking, demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation_final, overwhelming_power(6), archive_of_the_titans(20), ignition_mages_fuse(2)
3:16.801 build_a_shard K shadow_bolt Fluffy_Pillow 98916.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, demonic_calling, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation_final, overwhelming_power(5), archive_of_the_titans(20), ignition_mages_fuse(2)
3:18.060 nether_portal_active S hand_of_guldan Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, demonic_calling, wild_imps(12), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation_final, overwhelming_power(3), archive_of_the_titans(20), ignition_mages_fuse(3)
3:18.988 build_a_shard K shadow_bolt Fluffy_Pillow 98932.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, demonic_calling, wild_imps(13), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), overwhelming_power(3), archive_of_the_titans(20), ignition_mages_fuse(3)
3:20.307 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(14), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), overwhelming_power, archive_of_the_titans(20), ignition_mages_fuse(3)
3:21.839 build_a_shard K shadow_bolt Fluffy_Pillow 97537.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(14), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse(3)
3:23.374 default H hand_of_guldan Fluffy_Pillow 97072.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(14), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse(4)
3:24.489 default I demonbolt Fluffy_Pillow 98187.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_power, demonic_calling, wild_imps(14), vilefiend, tyrant, portal_summons(8), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse(4)
3:25.604 default I demonbolt Fluffy_Pillow 97302.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(14), vilefiend, portal_summons(8), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse(4)
3:26.720 default H hand_of_guldan Fluffy_Pillow 96418.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(16), vilefiend, portal_summons(8), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse(5)
3:27.803 default I demonbolt Fluffy_Pillow 97501.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(13), portal_summons(8), quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse(5)
3:28.881 build_a_shard K shadow_bolt Fluffy_Pillow 96579.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, supreme_commander, wild_imps(13), portal_summons(8), quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse(5)
3:30.318 build_a_shard K shadow_bolt Fluffy_Pillow 96016.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_calling, supreme_commander, wild_imps(13), quick_navigation(2), archive_of_the_titans(20)
3:31.996 default F call_dreadstalkers Fluffy_Pillow 95694.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_calling, supreme_commander, wild_imps(8), quick_navigation(3), archive_of_the_titans(20)
3:33.335 default H hand_of_guldan Fluffy_Pillow 97033.0/100000: 97% mana | 4.0/5: 80% soul_shard supreme_commander, wild_imps(5), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
3:34.588 build_a_shard K shadow_bolt Fluffy_Pillow 98286.0/100000: 98% mana | 1.0/5: 20% soul_shard supreme_commander, wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
3:36.248 build_a_shard K shadow_bolt Fluffy_Pillow 97946.0/100000: 98% mana | 2.0/5: 40% soul_shard supreme_commander, wild_imps(5), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
3:37.830 default H hand_of_guldan Fluffy_Pillow 97528.0/100000: 98% mana | 3.0/5: 60% soul_shard supreme_commander, wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
3:39.016 build_a_shard K shadow_bolt Fluffy_Pillow 98714.0/100000: 99% mana | 0.0/5: 0% soul_shard supreme_commander, wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
3:40.598 build_a_shard K shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
3:42.179 build_a_shard K shadow_bolt Fluffy_Pillow 97585.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
3:43.762 default H hand_of_guldan Fluffy_Pillow 97168.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
3:44.948 default I demonbolt Fluffy_Pillow 98354.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation_final, archive_of_the_titans(20)
3:46.134 default I demonbolt Fluffy_Pillow 97540.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(4), quick_navigation_final, archive_of_the_titans(20)
3:47.322 default H hand_of_guldan Fluffy_Pillow 96728.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), archive_of_the_titans(20)
3:48.597 build_a_shard K shadow_bolt Fluffy_Pillow 98003.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(4), archive_of_the_titans(20)
3:50.297 build_a_shard K shadow_bolt Fluffy_Pillow 97703.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(5), archive_of_the_titans(20)
3:51.997 default F call_dreadstalkers Fluffy_Pillow 97403.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), archive_of_the_titans(20)
3:53.361 build_a_shard K shadow_bolt Fluffy_Pillow 98767.0/100000: 99% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), archive_of_the_titans(20)
3:55.062 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), archive_of_the_titans(20)
3:56.761 build_a_shard K shadow_bolt Fluffy_Pillow 97704.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), archive_of_the_titans(20)
3:58.462 default E summon_vilefiend Fluffy_Pillow 97405.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(2), dreadstalkers(2), archive_of_the_titans(20)
4:00.162 default H hand_of_guldan Fluffy_Pillow 99105.0/100000: 99% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, dreadstalkers(2), vilefiend, archive_of_the_titans(20)
4:01.438 default D grimoire_felguard Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(20)
4:02.706 default I demonbolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps, dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation, archive_of_the_titans(20)
4:03.974 default I demonbolt Fluffy_Pillow 99268.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation, archive_of_the_titans(20)
4:05.242 default H hand_of_guldan Fluffy_Pillow 98536.0/100000: 99% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), vilefiend, grimoire_felguard, quick_navigation, archive_of_the_titans(20)
4:06.511 default I demonbolt Fluffy_Pillow 99805.0/100000: 100% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(3), vilefiend, grimoire_felguard, quick_navigation(2), archive_of_the_titans(20)
4:07.772 default H hand_of_guldan Fluffy_Pillow 99066.0/100000: 99% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(4), vilefiend, grimoire_felguard, quick_navigation(2), archive_of_the_titans(20)
4:09.030 default I demonbolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation(3), archive_of_the_titans(20)
4:10.281 build_a_shard K shadow_bolt Fluffy_Pillow 99251.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(7), vilefiend, grimoire_felguard, quick_navigation(3), archive_of_the_titans(20)
4:11.951 default F call_dreadstalkers Fluffy_Pillow 98005.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation(4), archive_of_the_titans(20)
4:13.330 build_a_shard K shadow_bolt Fluffy_Pillow 99384.0/100000: 99% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation(4), archive_of_the_titans(20)
4:14.989 default H hand_of_guldan Fluffy_Pillow 98004.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation(4), archive_of_the_titans(20)
4:16.234 build_a_shard K shadow_bolt Fluffy_Pillow 99249.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(5), dreadstalkers(2), grimoire_felguard, quick_navigation(4), archive_of_the_titans(20)
4:17.893 build_a_shard K shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
4:19.552 build_a_shard K shadow_bolt Fluffy_Pillow 97663.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
4:21.210 default H hand_of_guldan Fluffy_Pillow 97321.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
4:22.454 build_a_shard K shadow_bolt Fluffy_Pillow 98565.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
4:24.112 build_a_shard K shadow_bolt Fluffy_Pillow 98003.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation(4), archive_of_the_titans(20)
4:25.772 build_a_shard K shadow_bolt Fluffy_Pillow 97663.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation(4), archive_of_the_titans(20)
4:27.432 default H hand_of_guldan Fluffy_Pillow 97323.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(4), archive_of_the_titans(20)
4:28.677 build_a_shard K shadow_bolt Fluffy_Pillow 98568.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation_final, archive_of_the_titans(20)
4:30.260 default I demonbolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation_final, archive_of_the_titans(20)
4:31.448 default I demonbolt Fluffy_Pillow 97193.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(6), quick_navigation_final, archive_of_the_titans(20)
4:32.636 default F call_dreadstalkers Fluffy_Pillow 96381.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(3), quick_navigation_final, archive_of_the_titans(20)
4:33.823 default H hand_of_guldan Fluffy_Pillow 97568.0/100000: 98% mana | 4.0/5: 80% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:35.010 build_a_shard K shadow_bolt Fluffy_Pillow 98755.0/100000: 99% mana | 1.0/5: 20% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:36.594 build_a_shard K shadow_bolt Fluffy_Pillow 98006.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:38.176 default H hand_of_guldan Fluffy_Pillow 97588.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:39.363 build_a_shard K shadow_bolt Fluffy_Pillow 98775.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), archive_of_the_titans(20)
4:41.064 default G summon_demonic_tyrant Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), overwhelming_power(25), archive_of_the_titans(20)
4:42.534 build_a_shard K shadow_bolt Fluffy_Pillow 97475.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(6), dreadstalkers(2), tyrant, overwhelming_power(24), archive_of_the_titans(20)
4:44.014 build_a_shard K shadow_bolt Fluffy_Pillow 96955.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(6), dreadstalkers(2), tyrant, overwhelming_power(22), archive_of_the_titans(20)
4:45.510 default E summon_vilefiend Fluffy_Pillow 96451.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(6), dreadstalkers(2), tyrant, overwhelming_power(21), archive_of_the_titans(20)
4:47.013 build_a_shard K shadow_bolt Fluffy_Pillow 97954.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, overwhelming_power(19), archive_of_the_titans(20)
4:48.533 default H hand_of_guldan Fluffy_Pillow 97474.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, overwhelming_power(18), archive_of_the_titans(20)
4:49.679 build_a_shard K shadow_bolt Fluffy_Pillow 98620.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, overwhelming_power(17), archive_of_the_titans(20)
4:51.216 build_a_shard K shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, overwhelming_power(15), archive_of_the_titans(20)
4:52.773 default F call_dreadstalkers Fluffy_Pillow 97561.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, quick_navigation, overwhelming_power(14), archive_of_the_titans(20)
4:53.941 build_a_shard K shadow_bolt Fluffy_Pillow 98729.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(9), dreadstalkers(4), vilefiend, tyrant, quick_navigation, overwhelming_power(13), archive_of_the_titans(20)
4:55.505 build_a_shard K shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(9), dreadstalkers(4), vilefiend, tyrant, quick_navigation(2), overwhelming_power(11), archive_of_the_titans(20)
4:57.079 default H hand_of_guldan Fluffy_Pillow 97578.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(9), dreadstalkers(4), vilefiend, tyrant, quick_navigation(2), overwhelming_power(9), archive_of_the_titans(20)
4:58.274 default I demonbolt Fluffy_Pillow 98773.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core, supreme_commander, wild_imps(9), dreadstalkers(4), vilefiend, quick_navigation(2), overwhelming_power(8), archive_of_the_titans(20)
4:59.475 build_a_shard K shadow_bolt Fluffy_Pillow 97974.0/100000: 98% mana | 2.0/5: 40% soul_shard supreme_commander, wild_imps(10), dreadstalkers(4), vilefiend, quick_navigation(2), overwhelming_power(7), archive_of_the_titans(20)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 9026 8206 7205
Intellect 1467 -3 8475 7287 5476 (377)
Spirit 0 0 0 0 0
Health 180520 164120 0
Mana 100000 100000 0
Soul Shard 5 5 0
Spell Power 8475 7287 0
Crit 17.68% 17.68% 913
Haste 17.90% 17.90% 1217
Damage / Heal Versatility 1.52% 1.52% 129
ManaReg per Second 1000 1000 0
Mastery 26.55% 26.55% 742
Armor 1159 1159 1159
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Horrific Amalgam's Hood
ilevel: 390, stats: { 154 Armor, +655 Int, +1189 Sta }
azerite powers: { Supreme Commander, Overwhelming Power, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Amice of Corrupting Horror
ilevel: 390, stats: { 142 Armor, +491 Int, +892 Sta }
azerite powers: { Archive of the Titans, Heed My Call, Azerite Empowered }
Local Chest Robes of the Unraveler
ilevel: 390, stats: { 189 Armor, +655 Int, +1189 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Azerite Empowered }
Local Waist Cord of Septic Envelopment
ilevel: 385, stats: { 103 Armor, +247 Int, +417 Sta, +115 Haste, +68 Crit }
Local Legs Leggings of Lingering Infestation
ilevel: 385, stats: { 160 Armor, +329 Int, +556 Sta, +133 Haste, +112 Mastery }
Local Feet Volatile Walkers
ilevel: 385, stats: { 126 Armor, +247 Int, +417 Sta, +111 Crit, +72 Vers }
Local Wrists Void-Lashed Wristband
ilevel: 385, stats: { 80 Armor, +185 Int, +312 Sta, +81 Mastery, +57 Vers }
Local Hands Mutagenic Protofluid Handwraps
ilevel: 385, stats: { 114 Armor, +247 Int, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 370, stats: { +271 Int }
Local Trinket2 Vigilant's Bloodshaper
ilevel: 385, stats: { +313 Int }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Tusk of the Reborn Prophet
ilevel: 385, weapon: { 126 - 211, 1.8 }, stats: { +164 Int, +277 Sta, +70 Crit, +51 Haste, +792 Int }, enchant: quick_navigation
Local Off Hand Codex of Imminent Ruin
ilevel: 385, stats: { +277 Sta, +66 Haste, +56 Mastery, +503 Int }

Talents

Level
15 Dreadlash (Demonology Warlock) Demonic Strength (Demonology Warlock) Bilescourge Bombers (Demonology Warlock)
30 Demonic Calling (Demonology Warlock) Power Siphon (Demonology Warlock) Doom (Demonology Warlock)
45 Demon Skin Burning Rush Dark Pact
60 From the Shadows (Demonology Warlock) Soul Strike (Demonology Warlock) Summon Vilefiend (Demonology Warlock)
75 Darkfury Mortal Coil Demonic Circle
90 Soul Conduit (Demonology Warlock) Inner Demons (Demonology Warlock) Grimoire: Felguard (Demonology Warlock)
100 Sacrificed Souls (Demonology Warlock) Demonic Consumption (Demonology Warlock) Nether Portal (Demonology Warlock)

Profile

warlock="DL_GF_Felguard"
source=default
spec=demonology
level=120
race=troll
role=spell
position=ranged_back
talents=1103033

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/inner_demons,if=talent.inner_demons.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/demonbolt

# Executed every time the actor is available.
actions=potion,if=pet.demonic_tyrant.active|target.time_to_die<30
actions+=/use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
actions+=/demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
actions+=/call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
actions+=/call_action_list,name=implosion,if=spell_targets.implosion>1
actions+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions+=/summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions+=/call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions+=/summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
actions+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
actions+=/doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
actions+=/hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
actions+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
actions+=/bilescourge_bombers
actions+=/call_action_list,name=build_a_shard

actions.build_a_shard=demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
actions.build_a_shard+=/soul_strike
actions.build_a_shard+=/shadow_bolt

actions.implosion=implosion,if=(buff.wild_imps.stack>=6&(soul_shard<3|prev_gcd.1.call_dreadstalkers|buff.wild_imps.stack>=9|prev_gcd.1.bilescourge_bombers|(!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan))&!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan&buff.demonic_power.down)|(time_to_die<3&buff.wild_imps.stack>0)|(prev_gcd.2.call_dreadstalkers&buff.wild_imps.stack>2&!talent.demonic_calling.enabled)
actions.implosion+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.implosion+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.implosion+=/summon_demonic_tyrant
actions.implosion+=/hand_of_guldan,if=soul_shard>=5
actions.implosion+=/hand_of_guldan,if=soul_shard>=3&(((prev_gcd.2.hand_of_guldan|buff.wild_imps.stack>=3)&buff.wild_imps.stack<9)|cooldown.summon_demonic_tyrant.remains<=gcd*2|buff.demonic_power.remains>gcd*2)
actions.implosion+=/demonbolt,if=prev_gcd.1.hand_of_guldan&soul_shard>=1&(buff.wild_imps.stack<=3|prev_gcd.3.hand_of_guldan)&soul_shard<4&buff.demonic_core.up
actions.implosion+=/summon_vilefiend,if=(cooldown.summon_demonic_tyrant.remains>40&spell_targets.implosion<=2)|cooldown.summon_demonic_tyrant.remains<12
actions.implosion+=/bilescourge_bombers,if=cooldown.summon_demonic_tyrant.remains>9
actions.implosion+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions.implosion+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&(buff.demonic_core.stack>=3|buff.demonic_core.remains<=gcd*5.7)
actions.implosion+=/doom,cycle_targets=1,max_cycle_targets=7,if=refreshable
actions.implosion+=/call_action_list,name=build_a_shard

actions.nether_portal=call_action_list,name=nether_portal_building,if=cooldown.nether_portal.remains<20
actions.nether_portal+=/call_action_list,name=nether_portal_active,if=cooldown.nether_portal.remains>160

actions.nether_portal_active=grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.nether_portal_active+=/summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions.nether_portal_active+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.nether_portal_active+=/call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
actions.nether_portal_active+=/hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
actions.nether_portal_active+=/demonbolt,if=buff.demonic_core.up
actions.nether_portal_active+=/call_action_list,name=build_a_shard

actions.nether_portal_building=nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
actions.nether_portal_building+=/call_dreadstalkers
actions.nether_portal_building+=/hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
actions.nether_portal_building+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
actions.nether_portal_building+=/hand_of_guldan,if=soul_shard>=5
actions.nether_portal_building+=/call_action_list,name=build_a_shard

head=horrific_amalgams_hood,id=160616,bonus_id=4824/1507/4775,azerite_powers=458/30/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536,azerite_level=33
shoulders=amice_of_corrupting_horror,id=160726,bonus_id=4824/1507/4775,azerite_powers=483/22/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=robes_of_the_unraveler,id=160614,bonus_id=4824/1507/4775,azerite_powers=483/30/13
wrists=voidlashed_wristband,id=160617,bonus_id=4800/1507
hands=mutagenic_protofluid_handwraps,id=160715,bonus_id=4800/1507
waist=cord_of_septic_envelopment,id=160727,bonus_id=4800/1507
legs=leggings_of_lingering_infestation,id=160615,bonus_id=4800/1507
feet=volatile_walkers,id=160714,bonus_id=4800/1507
finger1=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=ignition_mages_fuse,id=159615,bonus_id=1542/4779
trinket2=vigilants_bloodshaper,id=160651,bonus_id=4800/1507
main_hand=tusk_of_the_reborn_prophet,id=160691,bonus_id=4800/1507,enchant=quick_navigation
off_hand=codex_of_imminent_ruin,id=160696,bonus_id=4800/1507

# Gear Summary
# gear_ilvl=385.25
# gear_stamina=7205
# gear_intellect=5476
# gear_crit_rating=913
# gear_haste_rating=1217
# gear_mastery_rating=742
# gear_versatility_rating=129
# gear_armor=1159
default_pet=felguard

DL_GF_Imp : 17193 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17193.2 17193.2 16.1 / 0.094% 2253.7 / 13.1% 4.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
963.3 954.4 Mana 0.00% 47.3 100.0% 100%
Talents
  • 15: Dreadlash (Demonology Warlock)
  • 30: Demonic Calling (Demonology Warlock)
  • 60: Summon Vilefiend (Demonology Warlock)
  • 90: Grimoire: Felguard (Demonology Warlock)
  • 100: Nether Portal (Demonology Warlock)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
DL_GF_Imp 17193
Demonbolt 1256 7.3% 44.2 6.22sec 8529 7496 Direct 45.0 7110 14226 8369 17.7%  

Stats details: demonbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.16 45.00 0.00 0.00 1.1379 0.0000 376632.47 376632.47 0.00 7495.62 7495.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.04 82.30% 7109.59 6520 8308 7110.67 6899 7331 263329 263329 0.00
crit 7.96 17.70% 14226.17 13040 16616 14223.69 0 16616 113303 113303 0.00
 
 

Action details: demonbolt

Static Values
  • id:264178
  • school:shadowflame
  • resource:mana
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:264178
  • name:Demonbolt
  • school:shadowflame
  • tooltip:
  • description:Send the fiery soul of a fallen demon at the enemy, causing {$s1=0} Shadowflame damage.$?c2[ |cFFFFFFFFGenerates 2 Soul Shards.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.667000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Hand of Gul'dan 1052 6.1% 60.4 4.90sec 5223 4740 Direct 60.3 4446 8913 5234 17.6%  

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.43 60.30 0.00 0.00 1.1019 0.0000 315601.00 315601.00 0.00 4739.96 4739.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.66 82.36% 4446.13 1634 5979 4439.69 4026 4794 220806 220806 0.00
crit 10.64 17.64% 8912.63 3267 11958 8905.94 4706 10798 94795 94795 0.00
 
 

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadowflame
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.7000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:2.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadowflame
  • tooltip:
  • description:Calls down a demonic meteor full of Wild Imps which burst forth to attack the target. Deals up to ${$m1*$86040m1} Shadowflame damage on impact to all enemies within $86040A1 yds of the target{$?s196283=false}[, applies Doom to each target,][] and summons up to ${$m1*{$104317m2=0}} Wild Imps, based on Soul Shards consumed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.160000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Heed My Call 140 (200) 0.8% (1.2%) 7.3 37.18sec 8271 0 Direct 7.3 4925 9849 5793 17.6%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.25 7.25 0.00 0.00 0.0000 0.0000 42002.61 42002.61 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.97 82.38% 4924.62 4925 4925 4921.67 0 4925 29417 29417 0.00
crit 1.28 17.62% 9849.24 9849 9849 7142.13 0 9849 12586 12586 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4620.00
  • base_dd_max:4620.00
 
    Heed My Call (_aoe) 60 0.3% 7.3 37.18sec 2479 0 Direct 7.3 2111 4221 2479 17.5%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.25 7.25 0.00 0.00 0.0000 0.0000 17974.94 17974.94 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.99 82.55% 2110.55 2111 2111 2110.55 2111 2111 12633 12633 0.00
crit 1.27 17.45% 4221.10 4221 4221 3018.69 0 4221 5342 5342 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1980.00
  • base_dd_max:1980.00
 
Shadow Bolt 1342 7.8% 95.7 3.05sec 4203 2814 Direct 95.1 3595 7190 4233 17.8%  

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.73 95.05 0.00 0.00 1.4939 0.0000 402375.42 402375.42 0.00 2813.58 2813.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.17 82.24% 3594.53 3373 4297 3595.12 3553 3657 280995 280995 0.00
crit 16.88 17.76% 7189.98 6745 8595 7191.34 6960 7637 121380 121380 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=0} Shadow damage.$?c2[ |cFFFFFFFFGenerates 1 Soul Shard.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.345000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Volatile Blood Explosion 287 1.7% 7.2 37.25sec 11880 0 Direct 7.1 10240 20481 12057 17.7%  

Stats details: volatile_blood_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.25 7.14 0.00 0.00 0.0000 0.0000 86075.83 86075.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.87 82.25% 10240.44 10240 10240 10236.34 0 10240 60125 60125 0.00
crit 1.27 17.75% 20480.88 20481 20481 14814.74 0 20481 25950 25950 0.00
 
 

Action details: volatile_blood_explosion

Static Values
  • id:278057
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278057
  • name:Volatile Blood Explosion
  • school:shadow
  • tooltip:
  • description:Your damaging spells have a chance to launch an orb of charged blood at your target, dealing {$s1=4788} Shadow damage split among all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9607.38
  • base_dd_max:9607.38
 
pet - imp 3147 / 3147
Firebolt 3147 18.3% 103.9 2.89sec 9078 6946 Direct 103.0 7775 15558 9150 17.7%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.86 103.04 0.00 0.00 1.3068 0.0000 942820.29 942820.29 0.00 6946.29 6946.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.84 82.33% 7774.51 7027 9401 7775.66 7645 7925 659565 659565 0.00
crit 18.21 17.67% 15558.21 14053 18802 15560.62 14554 16917 283255 283255 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.568000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - grimoire_felguard 4422 / 958
Felstorm 708 0.9% 3.9 80.74sec 11581 3947 Periodic 19.5 1989 3977 2340 17.6% 3.8%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.93 0.00 19.47 19.47 2.9341 0.5928 45565.55 65141.43 30.05 3947.12 3947.12
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.0 82.36% 1989.37 1864 2388 1990.04 1922 2155 31905 45613 30.05
crit 3.4 17.64% 3977.12 3728 4775 3885.04 0 4775 13660 19529 29.35
 
 

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $ Physical damage every $t1 sec. Unable to use other abilities.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc89751=The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Legion Strike 2008 2.5% 18.4 13.88sec 7004 7004 Direct 18.4 5955 11912 7003 17.6%  

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.45 18.45 0.00 0.00 1.0000 0.0000 129200.78 184708.03 30.05 7003.89 7003.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.20 82.39% 5954.97 5456 6990 5957.61 5686 6445 90513 129399 30.05
crit 3.25 17.61% 11911.79 10913 13979 11533.27 0 13314 38688 55309 29.08
 
 

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy>=100
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w2%.
  • description:A strong attack that deals $<damage> damage to all enemies in front of it, and reduces the effectiveness of any healing the victim receives by {$s2=10}% for {$d=6 seconds}. |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1706 2.1% 41.0 6.36sec 2680 2266 Direct 41.0 2280 4561 2680 17.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.95 40.95 0.00 0.00 1.1825 0.0000 109733.52 156877.24 30.05 2266.10 2266.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.78 82.48% 2280.09 2071 2653 2280.69 2213 2422 77015 110102 30.05
crit 7.17 17.52% 4561.09 4142 5306 4559.00 0 5087 32718 46775 30.02
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - shivarra 1943 / 261
melee 839 0.6% 42.5 2.71sec 783 666 Direct 42.5 665 1329 783 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.53 42.53 0.00 0.00 1.1763 0.0000 33295.93 47600.53 30.05 665.53 665.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.97 82.23% 664.67 587 717 665.53 587 714 23246 33233 30.05
crit 7.56 17.77% 1329.46 1175 1433 1313.60 0 1433 10050 14368 29.67
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 419 0.3% 42.5 2.71sec 391 315 Direct 42.5 332 665 391 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.53 42.53 0.00 0.00 1.2439 0.0000 16639.88 23788.71 30.05 314.52 314.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.00 82.29% 332.32 294 358 332.74 294 357 11631 16628 30.05
crit 7.53 17.71% 664.90 587 717 657.51 0 717 5009 7161 29.69
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Multi-Slash 0 (92) 0.0% (0.5%) 0.0 0.00sec 0 3973

Stats details: multislash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 3973.34 3973.34
 
 

Action details: multislash

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (1) 171 0.1% 6.9 18.19sec 994 0 Direct 6.9 843 1689 994 17.8%  

Stats details: multislash1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.88 6.88 0.00 0.00 0.0000 0.0000 6835.52 9772.20 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.65 82.17% 843.20 749 914 842.45 0 914 4765 6812 29.96
crit 1.23 17.83% 1688.88 1498 1827 1151.77 0 1827 2071 2960 20.48
 
 

Action details: multislash1

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (2) 171 0.1% 6.9 18.19sec 996 0 Direct 6.9 844 1686 996 18.1%  

Stats details: multislash2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.88 6.88 0.00 0.00 0.0000 0.0000 6846.73 9788.23 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.64 81.95% 843.50 749 914 840.92 0 914 4754 6796 29.90
crit 1.24 18.05% 1686.16 1498 1827 1150.07 0 1827 2093 2992 20.49
 
 

Action details: multislash2

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (3) 171 0.1% 6.9 18.19sec 991 0 Direct 6.9 843 1686 991 17.5%  

Stats details: multislash3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.88 6.88 0.00 0.00 0.0000 0.0000 6815.50 9743.58 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.67 82.49% 843.50 749 914 841.70 0 914 4785 6841 29.93
crit 1.20 17.51% 1686.15 1498 1827 1142.11 0 1827 2031 2903 20.35
 
 

Action details: multislash3

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (4) 171 0.1% 6.9 18.19sec 992 0 Direct 6.9 843 1690 992 17.6%  

Stats details: multislash4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.88 6.88 0.00 0.00 0.0000 0.0000 6822.92 9754.18 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.67 82.40% 843.13 749 914 841.11 0 914 4777 6830 29.91
crit 1.21 17.60% 1689.61 1498 1827 1147.86 0 1827 2045 2924 20.41
 
 

Action details: multislash4

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - darkhound 1304 / 176
Fel Bite 467 0.4% 8.9 12.88sec 2114 2114 Direct 8.9 1796 3589 2114 17.7%  

Stats details: fel_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.89 8.89 0.00 0.00 1.0000 0.0000 18803.30 26881.57 30.05 2114.16 2114.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.32 82.26% 1795.68 1586 1935 1795.78 0 1935 13139 18783 30.00
crit 1.58 17.74% 3589.25 3172 3870 2666.05 0 3870 5665 8098 22.30
 
 

Action details: fel_bite

Static Values
  • id:272435
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272435
  • name:Fel Bite
  • school:physical
  • tooltip:
  • description:The Darkhound bites its target, causing serious Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 837 0.6% 42.6 2.60sec 782 666 Direct 42.6 665 1330 782 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.59 42.59 0.00 0.00 1.1750 0.0000 33321.98 47637.77 30.05 665.89 665.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.07 82.35% 664.98 587 717 665.54 587 714 23324 33345 30.05
crit 7.52 17.65% 1330.26 1175 1433 1313.55 0 1433 9998 14293 29.64
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - vilefiend 3209 / 1517
Bile Spit 1168 3.2% 6.8 47.23sec 24291 0 Direct 6.8 8929 17871 10503 17.6%  
Periodic 33.2 2822 0 2822 0.0% 22.1%

Stats details: bile_spit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.78 6.77 33.16 33.16 0.0000 2.0000 164659.64 164659.64 0.00 2482.62 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.58 82.40% 8928.73 8474 10104 8928.03 8505 9664 49795 49795 0.00
crit 1.19 17.60% 17871.04 16947 20207 13084.23 0 20207 21293 21293 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.2 100.00% 2821.56 2502 3310 2822.33 2633 2885 93572 93572 0.00
 
 

Action details: bile_spit

Static Values
  • id:267997
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:65.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267997
  • name:Bile Spit
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:The Vilefiend spits a ball of bile at its target, dealing ${$m1*$<demoMastery>} Nature damage and an additional ${$m2*$<demoMastery>} Nature damage every $t2 sec for {$d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.680000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.200000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Headbutt 736 2.0% 28.5 10.28sec 3662 3662 Direct 28.5 3105 6212 3662 17.9%  

Stats details: headbutt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.50 28.50 0.00 0.00 1.0000 0.0000 104379.69 149223.30 30.05 3662.06 3662.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.40 82.08% 3105.41 2737 3621 3106.82 2942 3267 72657 103872 30.05
crit 5.11 17.92% 6212.32 5474 7243 6178.12 0 7243 31723 45351 29.85
 
 

Action details: headbutt

Static Values
  • id:267999
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267999
  • name:Headbutt
  • school:physical
  • tooltip:
  • description:The Vilefiend rams its bladed head into the target, dealing {$s1=0} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1306 3.6% 102.8 2.82sec 1801 1353 Direct 102.8 1531 3062 1801 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 102.77 102.77 0.00 0.00 1.3307 0.0000 185053.31 264555.93 30.05 1353.18 1353.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.64 82.36% 1530.51 1337 1775 1531.06 1481 1576 129539 185191 30.05
crit 18.13 17.64% 3062.09 2673 3550 3063.37 2795 3323 55514 79364 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - dreadstalker 3641 / 2406
Dreadbite 1335 5.1% 29.1 20.93sec 9086 0 Direct 29.1 7719 15438 9087 17.7%  

Stats details: dreadbite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.09 29.09 0.00 0.00 0.0000 0.0000 264331.51 264331.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.94 82.28% 7718.65 7139 9517 7719.13 7415 7963 184754 184754 0.00
crit 5.15 17.72% 15438.04 14278 19033 15380.91 0 19033 79578 79578 0.00
 
 

Action details: dreadbite

Static Values
  • id:205196
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205196
  • name:Dreadbite
  • school:shadow
  • tooltip:
  • description:Bite the target, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 2306 8.9% 312.2 1.89sec 1464 1106 Direct 312.2 1244 2488 1464 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 312.23 312.23 0.00 0.00 1.3235 0.0000 456994.73 653328.85 30.05 1105.89 1105.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 257.05 82.33% 1243.80 1101 1473 1243.98 1228 1266 319717 457074 30.05
crit 55.18 17.67% 2487.90 2203 2947 2488.29 2369 2636 137278 196255 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.83
 
pet - eye_of_guldan 996 / 81
Eye of Gul'dan 996 0.5% 27.2 4.08sec 876 1153 Periodic 59.6 400 0 400 0.0% 58.4%

Stats details: eye_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.24 0.00 59.63 59.63 0.7598 2.9354 23860.12 23860.12 0.00 121.90 1153.05
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.6 100.00% 400.11 181 461 399.19 368 406 23860 23860 0.00
 
 

Action details: eye_of_guldan

Static Values
  • id:272131
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272131
  • name:Eye of Gul'dan
  • school:shadowflame
  • tooltip:Suffering Shadow damage every $t1 sec.
  • description:The Eye of Gul'dan stares deep into the target's soul, causing Shadow Damage every $t1 sec for {$d=15 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.300000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - wild_imp 2576 / 2476
Fel Firebolt 2576 14.4% 995.0 0.29sec 746 502 Direct 990.9 637 1274 750 17.7%  

Stats details: fel_firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 995.01 990.87 0.00 0.00 1.4873 0.0000 742765.32 742765.32 0.00 501.90 501.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 815.76 82.33% 637.00 569 761 637.02 625 650 519640 519640 0.00
crit 175.11 17.67% 1274.20 1138 1523 1274.26 1239 1314 223125 223125 0.00
 
 

Action details: fel_firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Fel Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.046000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - demonic_tyrant 4661 / 824
Demonfire 4661 4.8% 37.8 6.89sec 6530 4890 Direct 37.7 5561 11116 6545 17.7%  

Stats details: demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.77 37.68 0.00 0.00 1.3354 0.0000 246634.58 246634.58 0.00 4890.15 4890.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.01 82.29% 5561.34 5312 5917 5564.71 5437 5682 172459 172459 0.00
crit 6.67 17.71% 11116.21 10624 11834 11113.97 0 11834 74175 74175 0.00
 
 

Action details: demonfire

Static Values
  • id:270481
  • school:shadowflame
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:270481
  • name:Demonfire
  • school:shadowflame
  • tooltip:
  • description:Deal {$s1=0} Shadowflame damage to your enemy target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.357500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - urzul 1336 / 180
Many Faced Bite 498 0.4% 9.4 12.21sec 2110 2110 Direct 9.4 1792 3584 2110 17.7%  

Stats details: many_faced_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.45 9.45 0.00 0.00 1.0000 0.0000 19933.97 28498.01 30.05 2110.08 2110.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.77 82.27% 1792.27 1586 1935 1792.90 0 1935 13930 19915 30.01
crit 1.68 17.73% 3584.04 3172 3870 2737.16 0 3870 6004 8583 22.93
 
 

Action details: many_faced_bite

Static Values
  • id:272439
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272439
  • name:Many Faced Bite
  • school:physical
  • tooltip:
  • description:The Ur'zul rears up and bites its target, dealing Physical damage. You're not sure which face actually bit you after thinking about it.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 838 0.6% 42.5 2.61sec 783 665 Direct 42.5 665 1329 783 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.52 42.52 0.00 0.00 1.1760 0.0000 33272.78 47567.43 30.05 665.47 665.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.98 82.28% 664.77 587 717 665.60 587 714 23255 33246 30.05
crit 7.54 17.72% 1329.32 1175 1433 1314.83 0 1433 10018 14321 29.68
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - vicious_hellhound 1067 / 143
Demon Fangs 656 0.5% 9.3 12.41sec 2818 2818 Direct 9.3 2393 4793 2818 17.7%  

Stats details: demon_fangs

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.27 9.27 0.00 0.00 1.0000 0.0000 26110.41 26110.41 0.00 2817.87 2817.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.63 82.31% 2393.35 2116 2582 2392.14 0 2582 18255 18255 0.00
crit 1.64 17.69% 4792.56 4233 5163 3629.68 0 5163 7856 7856 0.00
 
 

Action details: demon_fangs

Static Values
  • id:272013
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272013
  • name:Demon Fangs
  • school:shadowflame
  • tooltip:
  • description:The Vicious Hellhound chomps at its target, dealing Shadowflame damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 410 0.3% 82.5 1.34sec 196 327 Direct 82.5 167 333 196 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.53 82.53 0.00 0.00 0.5999 0.0000 16183.79 23136.67 30.05 326.88 326.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.93 82.30% 166.60 147 179 166.76 147 178 11317 16179 30.05
crit 14.61 17.70% 333.22 294 358 333.37 0 358 4867 6958 30.04
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - bilescourge 3894 / 523
Toxic Bile 3894 3.0% 54.7 2.05sec 2826 3032 Direct 54.7 2401 4802 2826 17.7%  

Stats details: toxic_bile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.68 54.68 0.00 0.00 0.9322 0.0000 154518.94 154518.94 0.00 3031.69 3031.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.99 82.28% 2400.63 2116 2582 2402.51 2116 2571 108001 108001 0.00
crit 9.69 17.72% 4802.13 4233 5163 4776.51 0 5163 46518 46518 0.00
 
 

Action details: toxic_bile

Static Values
  • id:272167
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272167
  • name:Toxic Bile
  • school:nature
  • tooltip:
  • description:The Bilescourge spits wads of Toxic Bile at its target, dealing Nature damage.
 
pet - illidari_satyr 1261 / 169
melee 417 0.3% 42.2 2.73sec 391 333 Direct 42.2 332 665 391 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.20 42.20 0.00 0.00 1.1746 0.0000 16512.22 23606.20 30.05 333.17 333.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.73 82.30% 332.46 294 358 332.83 294 357 11546 16506 30.05
crit 7.47 17.70% 665.02 587 717 657.70 0 717 4967 7100 29.69
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 208 0.2% 42.2 2.73sec 196 158 Direct 42.2 166 332 196 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.20 42.20 0.00 0.00 1.2417 0.0000 8253.99 11800.07 30.05 157.53 157.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.74 82.32% 166.25 147 179 166.44 147 178 5775 8256 30.05
crit 7.46 17.68% 332.37 294 358 327.34 0 358 2479 3544 29.58
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Shadow Slash 636 0.5% 9.0 13.20sec 2822 2822 Direct 9.0 2395 4794 2822 17.8%  

Stats details: shadow_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.01 9.01 0.00 0.00 1.0000 0.0000 25416.41 25416.41 0.00 2822.16 2822.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.40 82.21% 2395.48 2116 2582 2397.04 0 2582 17736 17736 0.00
crit 1.60 17.79% 4793.54 4233 5163 3608.54 0 5163 7681 7681 0.00
 
 

Action details: shadow_slash

Static Values
  • id:272012
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272012
  • name:Shadow Slash
  • school:shadow
  • tooltip:
  • description:The Satyr strikes at out with its weapons, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - wrathguard 1729 / 232
melee 841 0.6% 42.5 2.68sec 783 666 Direct 42.5 665 1330 783 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.51 42.51 0.00 0.00 1.1762 0.0000 33298.67 47604.45 30.05 665.93 665.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.95 82.20% 664.88 587 717 665.72 587 714 23235 33217 30.05
crit 7.57 17.80% 1330.14 1175 1433 1316.55 0 1433 10064 14387 29.72
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 420 0.3% 42.5 2.68sec 391 314 Direct 42.5 332 665 391 17.6%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.51 42.51 0.00 0.00 1.2435 0.0000 16620.62 23761.17 30.05 314.40 314.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.03 82.40% 332.47 294 358 332.88 294 357 11646 16650 30.05
crit 7.48 17.60% 664.78 587 717 656.43 0 717 4974 7111 29.63
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Overhead Assault 468 0.4% 8.9 13.30sec 2110 2110 Direct 8.9 1795 3592 2110 17.5%  

Stats details: overhead_assault

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.88 8.88 0.00 0.00 1.0000 0.0000 18727.98 26773.89 30.05 2109.96 2109.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.32 82.49% 1795.29 1586 1935 1794.57 0 1935 13145 18792 29.97
crit 1.55 17.51% 3592.49 3172 3870 2662.86 0 3870 5583 7982 22.24
 
 

Action details: overhead_assault

Static Values
  • id:272432
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272432
  • name:Overhead Assault
  • school:physical
  • tooltip:
  • description:The Wrathguard smashes its target with a heavy overhand swing.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - void_terror 1838 / 249
Double Breath 0 (135) 0.0% (0.8%) 0.0 0.00sec 0 7397

Stats details: double_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 7397.34 7397.34
 
 

Action details: double_breath

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (1) 495 0.4% 7.1 17.07sec 2800 0 Direct 7.1 2388 4775 2800 17.2%  

Stats details: double_breath1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.11 7.11 0.00 0.00 0.0000 0.0000 19898.54 19898.54 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.88 82.78% 2388.48 2116 2582 2384.28 0 2582 14053 14053 0.00
crit 1.22 17.22% 4775.46 4233 5163 3211.30 0 5163 5846 5846 0.00
 
 

Action details: double_breath1

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (2) 498 0.4% 7.1 17.07sec 2812 0 Direct 7.1 2389 4774 2812 17.8%  

Stats details: double_breath2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.11 7.11 0.00 0.00 0.0000 0.0000 19987.91 19987.91 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.85 82.25% 2388.60 2116 2582 2382.72 0 2582 13964 13964 0.00
crit 1.26 17.75% 4774.39 4233 5163 3295.94 0 5163 6024 6024 0.00
 
 

Action details: double_breath2

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
melee 844 0.7% 43.1 2.65sec 782 664 Direct 43.1 665 1329 782 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.06 43.06 0.00 0.00 1.1780 0.0000 33666.60 48130.45 30.05 663.76 663.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.47 82.37% 664.84 587 717 665.41 587 714 23580 33711 30.05
crit 7.59 17.63% 1328.95 1175 1433 1313.76 0 1433 10086 14419 29.67
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - prince_malchezaar 4649 / 393
melee 3107 1.5% 20.9 1.32sec 3709 3136 Direct 20.9 3145 6300 3709 17.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.95 20.95 0.00 0.00 1.1829 0.0000 77697.68 111078.17 30.05 3135.63 3135.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.21 82.14% 3145.33 2784 3396 3152.20 2784 3370 54120 77371 30.05
crit 3.74 17.86% 6300.49 5567 6791 6101.39 0 6791 23577 33707 29.02
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 1542 0.7% 20.9 1.32sec 1839 1471 Direct 20.9 1574 3139 1839 16.9%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.95 20.95 0.00 0.00 1.2499 0.0000 38517.85 55065.90 30.05 1471.05 1471.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.40 83.08% 1573.79 1392 1698 1577.22 1392 1692 27391 39159 30.05
crit 3.54 16.92% 3139.46 2784 3396 3048.26 0 3396 11127 15907 29.15
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
DL_GF_Imp
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_GF_Imp
  • harmful:false
  • if_expr:
 
Berserking 2.0 187.28sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:pet.demonic_tyrant.active|target.time_to_die<=15
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Call Dreadstalkers 14.6 20.93sec

Stats details: call_dreadstalkers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.60 0.00 0.00 0.00 1.2021 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: call_dreadstalkers

Static Values
  • id:104316
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:20.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
Spelldata
  • id:104316
  • name:Call Dreadstalkers
  • school:shadow
  • tooltip:
  • description:Summons {$s1=2} ferocious Dreadstalkers to attack the target for {$193332d=12 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_GF_Imp
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_GF_Imp
  • harmful:false
  • if_expr:
 
Grimoire: Felguard 3.0 120.75sec

Stats details: grimoire_felguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 1.1280 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: grimoire_felguard

Static Values
  • id:111898
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
Spelldata
  • id:111898
  • name:Grimoire: Felguard
  • school:shadow
  • tooltip:
  • description:Summons a Felguard who attacks the target for {$s1=15} sec that deals {$216187s1=25}% increased damage. This Felguard will stun their target when summoned.
 
Nether Portal 2.0 0.00sec

Stats details: nether_portal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.2379 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: nether_portal

Static Values
  • id:267217
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Spelldata
  • id:267217
  • name:Nether Portal
  • school:shadow
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Summon Demonic Tyrant 3.6 93.49sec

Stats details: summon_demonic_tyrant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.60 0.00 0.00 0.00 1.5119 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_demonic_tyrant

Static Values
  • id:265187
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
Spelldata
  • id:265187
  • name:Summon Demonic Tyrant
  • school:shadow
  • tooltip:
  • description:Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.
 
summon_random_demon 15.1 14.65sec

Stats details: summon_random_demon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.14 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_random_demon

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
 
Summon Vilefiend 6.8 47.23sec

Stats details: summon_vilefiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.78 0.00 0.00 0.00 1.5398 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_vilefiend

Static Values
  • id:264119
  • school:fire
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Spelldata
  • id:264119
  • name:Summon Vilefiend
  • school:fire
  • tooltip:
  • description:Summon a Vilefiend to fight for you for the next {$d=15 seconds}.
 
pet - grimoire_felguard
Axe Toss 4.0 80.14sec

Stats details: axe_toss

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.98 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: axe_toss

Static Values
  • id:89766
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89766
  • name:Axe Toss
  • school:physical
  • tooltip:Stunned for {$d=4 seconds}.
  • description:The $?s108499[Wrathguard][Felguard] hurls its weapon, stunning the target for {$89766d=4 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:28.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=7}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 100.1sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 187.3sec 187.3sec 6.76% 8.41% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Demonic Calling 12.8 15.4 23.2sec 10.2sec 51.66% 83.62% 15.4(15.4) 0.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_calling_1:51.66%

Trigger Attempt Success

  • trigger_pct:19.97%

Spelldata details

  • id:205146
  • name:Demonic Calling
  • tooltip:Your next Call Dreadstalkers costs {$205145s1=1} less Soul Shard and has no cast time.
  • description:{$@spelldesc205145=Shadow Bolt{$?s264178=true}[ and Demonbolt have][ has] a {$h=20}% chance to make your next Call Dreadstalkers cost {$s1=1} less Soul Shard and have no cast time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Demonic Core 23.4 30.1 12.4sec 5.3sec 38.67% 100.00% 4.4(4.4) 0.4

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_demonic_core
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_core_1:15.81%
  • demonic_core_2:15.71%
  • demonic_core_3:5.00%
  • demonic_core_4:2.16%

Trigger Attempt Success

  • trigger_pct:25.77%

Spelldata details

  • id:264173
  • name:Demonic Core
  • tooltip:The cast time of Demonbolt is reduced by {$s1=100}%.
  • description:{$@spelldesc267102=When your Wild Imps expend all of their energy or are imploded, you have a {$s1=10}% chance to absorb their life essence, granting you a stack of Demonic Core. When your summoned Dreadstalkers fade away, you have a {$s2=100}% chance to absorb their life essence, granting you a stack of Demonic Core. Demonic Core reduces the cast time of Demonbolt by {$264173s1=100}%. Maximum {$264173u=4} stacks.}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Demonic Power 3.6 0.0 93.5sec 93.5sec 17.69% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_demonic_power
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_power_1:17.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:265273
  • name:Demonic Power
  • tooltip:Damage dealt by your demons increased by {$s2=15}%.
  • description:{$@spelldesc265187=Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
dreadstalkers 11.6 17.6 26.6sec 10.1sec 66.08% 0.00% 0.0(0.0) 10.9

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_dreadstalkers
  • max_stacks:4
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • dreadstalkers_2:59.63%
  • dreadstalkers_4:6.45%

Trigger Attempt Success

  • trigger_pct:100.00%
eyes_of_guldan 0.1 0.5 180.4sec 1.7sec 1.20% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_eyes_of_guldan
  • max_stacks:4
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • eyes_of_guldan_4:1.20%

Trigger Attempt Success

  • trigger_pct:100.00%
grimoire_felguard 3.0 0.0 120.7sec 120.7sec 19.75% 0.00% 0.0(0.0) 2.9

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_grimoire_felguard
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • grimoire_felguard_1:19.75%

Trigger Attempt Success

  • trigger_pct:100.00%
Ignition Mage's Fuse 2.4 0.0 171.5sec 171.5sec 14.87% 0.00% 2.0(2.0) 2.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:275.80

Stack Uptimes

  • ignition_mages_fuse_1:3.13%
  • ignition_mages_fuse_2:3.09%
  • ignition_mages_fuse_3:3.05%
  • ignition_mages_fuse_4:2.88%
  • ignition_mages_fuse_5:2.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Nether Portal 2.0 0.0 182.8sec 0.0sec 10.14% 18.25% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_nether_portal
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • nether_portal_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267217
  • name:Nether Portal
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Overwhelming Power 4.3 2.9 67.3sec 36.9sec 44.10% 0.00% 2.9(40.8) 0.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • overwhelming_power_1:1.30%
  • overwhelming_power_2:1.33%
  • overwhelming_power_3:1.37%
  • overwhelming_power_4:1.40%
  • overwhelming_power_5:1.44%
  • overwhelming_power_6:1.48%
  • overwhelming_power_7:1.52%
  • overwhelming_power_8:1.55%
  • overwhelming_power_9:1.60%
  • overwhelming_power_10:1.64%
  • overwhelming_power_11:1.68%
  • overwhelming_power_12:1.73%
  • overwhelming_power_13:1.77%
  • overwhelming_power_14:1.82%
  • overwhelming_power_15:1.87%
  • overwhelming_power_16:1.93%
  • overwhelming_power_17:1.98%
  • overwhelming_power_18:2.03%
  • overwhelming_power_19:2.09%
  • overwhelming_power_20:2.15%
  • overwhelming_power_21:2.21%
  • overwhelming_power_22:2.27%
  • overwhelming_power_23:2.34%
  • overwhelming_power_24:2.40%
  • overwhelming_power_25:1.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
portal_summons 2.0 13.1 182.8sec 14.7sec 19.60% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_portal_summons
  • max_stacks:40
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • portal_summons_1:2.02%
  • portal_summons_2:0.76%
  • portal_summons_3:1.26%
  • portal_summons_4:1.97%
  • portal_summons_5:1.37%
  • portal_summons_6:1.77%
  • portal_summons_7:4.32%
  • portal_summons_8:6.11%
  • portal_summons_9:0.05%

Trigger Attempt Success

  • trigger_pct:100.00%
prince_malchezaar 0.1 0.0 181.6sec 84.0sec 1.19% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_prince_malchezaar
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • prince_malchezaar_1:1.20%

Trigger Attempt Success

  • trigger_pct:100.00%
Quick Navigation 6.0 22.4 52.4sec 10.3sec 67.65% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:17.57%
  • quick_navigation_2:17.29%
  • quick_navigation_3:16.67%
  • quick_navigation_4:16.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.3 0.0 52.3sec 52.3sec 17.45% 0.00% 0.0(0.0) 5.1

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:17.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Supreme Commander 4.4 0.1 82.6sec 79.9sec 17.08% 0.00% 0.1(0.1) 3.4

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_supreme_commander
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:838.00

Stack Uptimes

  • supreme_commander_1:17.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279878
  • name:Supreme Commander
  • tooltip:
  • description:When your Demonic Tyrant expires, consume its life essence, granting you a stack of Demonic Core and increasing your Intellect by {$s1=398} for {$279885d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tyrant 3.6 0.0 93.5sec 93.5sec 17.69% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_tyrant
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • tyrant_1:17.69%

Trigger Attempt Success

  • trigger_pct:100.00%
vilefiend 6.8 0.0 47.2sec 47.2sec 47.40% 0.00% 0.0(0.0) 6.4

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_vilefiend
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vilefiend_1:47.40%

Trigger Attempt Success

  • trigger_pct:100.00%
wild_imps 5.2 153.7 55.7sec 0.0sec 96.12% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_wild_imps
  • max_stacks:40
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • wild_imps_1:2.31%
  • wild_imps_2:2.75%
  • wild_imps_3:28.82%
  • wild_imps_4:7.66%
  • wild_imps_5:9.48%
  • wild_imps_6:26.07%
  • wild_imps_7:5.87%
  • wild_imps_8:3.98%
  • wild_imps_9:4.76%
  • wild_imps_10:1.53%
  • wild_imps_11:1.14%
  • wild_imps_12:1.11%
  • wild_imps_13:0.42%
  • wild_imps_14:0.17%
  • wild_imps_15:0.05%
  • wild_imps_16:0.01%
  • wild_imps_17:0.00%
grimoire_felguard: Grimoire of Service 3.0 0.0 120.7sec 120.7sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_GF_Imp_grimoire_felguard
  • cooldown name:buff_grimoire_of_service
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • grimoire_of_service_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216187
  • name:Grimoire of Service
  • tooltip:Summoned by a Grimoire of Service. Damage done increased by {$s1=25}%.
  • description:{$@spelldesc108501=Summons a second demon which fights for you for {$s1=25} sec and deals {$216187s1=25}% increased damage. 1.5 min cooldown. The demon will immmediately use one of its special abilities when summoned: $@spellname111859: Cleanses 1 harmful Magic effect from you. $@spellname111895 Taunts its target. $@spellname111896 Seduces its target. $@spellname111897 Interrupts its target.$?c2[ $@spellname111898 Stuns its target.][]}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
summon_random_demon 15.1 13.9sec
one_shard_hog 8.9 21.6sec
two_shard_hog 3.8 16.5sec
three_shard_hog 47.7 5.8sec
portal_summon 15.1 13.9sec

Resources

Resource Usage Type Count Total Average RPE APR
DL_GF_Imp
call_dreadstalkers Soul Shard 14.6 17.0 1.2 1.2 0.0
demonbolt Mana 45.2 90315.0 2000.0 2045.2 4.2
grimoire_felguard Soul Shard 3.0 3.0 1.0 1.0 0.0
hand_of_guldan Soul Shard 60.4 159.7 2.6 2.6 1975.7
shadow_bolt Mana 95.7 191467.9 2000.0 2000.0 2.1
summon_demonic_tyrant Mana 3.6 7204.9 2000.0 2000.1 0.0
summon_vilefiend Soul Shard 6.8 6.8 1.0 1.0 0.0
pet - imp
firebolt Energy 103.9 4154.5 40.0 40.0 226.9
pet - grimoire_felguard
felstorm Energy 3.9 236.1 60.0 60.0 193.0
legion_strike Energy 18.4 1106.9 60.0 60.0 116.7
pet - wild_imp
fel_firebolt Energy 995.0 15591.6 15.7 15.7 47.6
Resource Gains Type Count Total Average Overflow
demonbolt Soul Shard 45.16 90.30 (48.54%) 2.00 0.01 0.01%
shadow_bolt Soul Shard 95.73 95.73 (51.46%) 1.00 0.00 0.00%
mana_regen Mana 554.69 286300.76 (100.00%) 516.15 13140.34 4.39%
pet - imp
energy_regen Energy 427.73 3983.59 (100.00%) 9.31 22.74 0.57%
pet - grimoire_felguard
energy_regen Energy 91.73 914.64 (100.00%) 9.97 48.41 5.03%
pet - demonic_tyrant
energy_regen Energy 37.77 0.00 (0.00%) 0.00 762.42 100.00%
pet - bilescourge
energy_regen Energy 9.85 0.00 (0.00%) 0.00 136.38 100.00%
pet - bilescourge
energy_regen Energy 11.22 0.00 (0.00%) 0.00 155.91 100.00%
pet - bilescourge
energy_regen Energy 13.95 0.00 (0.00%) 0.00 193.05 100.00%
pet - bilescourge
energy_regen Energy 9.89 0.00 (0.00%) 0.00 136.86 100.00%
pet - bilescourge
energy_regen Energy 3.62 0.00 (0.00%) 0.00 50.33 100.00%
pet - bilescourge
energy_regen Energy 2.62 0.00 (0.00%) 0.00 36.35 100.00%
pet - bilescourge
energy_regen Energy 0.00 0.00 (0.00%) 0.00 0.04 100.00%
Resource RPS-Gain RPS-Loss
Mana 954.37 963.33
Soul Shard 0.62 0.62
Combat End Resource Mean Min Max
Mana 97313.81 92950.00 100000.00
Soul Shard 2.62 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.7%

Statistics & Data Analysis

Fight Length
Sample Data DL_GF_Imp Fight Length
Count 4999
Mean 299.99
Minimum 240.01
Maximum 359.96
Spread ( max - min ) 119.95
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data DL_GF_Imp Damage Per Second
Count 4999
Mean 17193.16
Minimum 15533.84
Maximum 19652.45
Spread ( max - min ) 4118.61
Range [ ( max - min ) / 2 * 100% ] 11.98%
Standard Deviation 580.7690
5th Percentile 16318.34
95th Percentile 18232.17
( 95th Percentile - 5th Percentile ) 1913.83
Mean Distribution
Standard Deviation 8.2141
95.00% Confidence Intervall ( 17177.06 - 17209.26 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4384
0.1 Scale Factor Error with Delta=300 2880
0.05 Scale Factor Error with Delta=300 11518
0.01 Scale Factor Error with Delta=300 287933
Priority Target DPS
Sample Data DL_GF_Imp Priority Target Damage Per Second
Count 4999
Mean 17193.16
Minimum 15533.84
Maximum 19652.45
Spread ( max - min ) 4118.61
Range [ ( max - min ) / 2 * 100% ] 11.98%
Standard Deviation 580.7690
5th Percentile 16318.34
95th Percentile 18232.17
( 95th Percentile - 5th Percentile ) 1913.83
Mean Distribution
Standard Deviation 8.2141
95.00% Confidence Intervall ( 17177.06 - 17209.26 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4384
0.1 Scale Factor Error with Delta=300 2880
0.05 Scale Factor Error with Delta=300 11518
0.01 Scale Factor Error with Delta=300 287933
DPS(e)
Sample Data DL_GF_Imp Damage Per Second (Effective)
Count 4999
Mean 17193.16
Minimum 15533.84
Maximum 19652.45
Spread ( max - min ) 4118.61
Range [ ( max - min ) / 2 * 100% ] 11.98%
Damage
Sample Data DL_GF_Imp Damage
Count 4999
Mean 1240662.28
Minimum 896734.42
Maximum 1646882.64
Spread ( max - min ) 750148.21
Range [ ( max - min ) / 2 * 100% ] 30.23%
DTPS
Sample Data DL_GF_Imp Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data DL_GF_Imp Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data DL_GF_Imp Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data DL_GF_Imp Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data DL_GF_Imp Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data DL_GF_Imp Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data DL_GF_ImpTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data DL_GF_Imp Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 inner_demons,if=talent.inner_demons.enabled
5 0.00 snapshot_stats
6 0.00 potion
7 0.00 demonbolt
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,if=pet.demonic_tyrant.active|target.time_to_die<30
9 2.38 use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
A 2.00 berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
0.00 demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
B 0.00 call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
C 0.00 call_action_list,name=implosion,if=spell_targets.implosion>1
D 1.98 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
E 4.81 summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
F 11.59 call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
G 1.63 summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
0.00 doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
H 44.45 hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
0.00 soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
I 40.36 demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
0.00 bilescourge_bombers
J 0.00 call_action_list,name=build_a_shard
actions.build_a_shard
# count action,conditions
0.00 demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
0.00 soul_strike
K 96.26 shadow_bolt
actions.nether_portal_active
# count action,conditions
O 1.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
P 2.00 summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Q 2.00 call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
R 0.00 call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
S 13.71 hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
T 1.94 summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
U 0.04 summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
V 3.80 demonbolt,if=buff.demonic_core.up
W 0.00 call_action_list,name=build_a_shard
actions.nether_portal_building
# count action,conditions
X 2.00 nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Y 1.02 call_dreadstalkers
Z 0.53 hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
a 1.94 hand_of_guldan,if=soul_shard>=5
b 0.00 call_action_list,name=build_a_shard

Sample Sequence

012367XOPQST9AKSKSKSKSKSKSKKKKKHFIHKKKHIIHKKHIIHKKKFKEHKKKHKIHIKKKFHKKHKKKHIKHKKIFHIKIHEG8KIHKKKFHKKKHIIHDIIHIIHFKKKHIIHIKKEHIIHFKKKHIKKKaKKKaKYKKKXSSVSVSVST9AVPQVSVVHKKHKKKHIIKHIFHIIHIHKKKHIIKHKFKIHDEIKHIIHKKKFHIKHKKKHKKKIHFIHKKGKKEHKKKFK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask DL_GF_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food DL_GF_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 augmentation DL_GF_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_imp Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 potion Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard battle_potion_of_intellect
0:00.000 precombat 7 demonbolt Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard battle_potion_of_intellect
0:00.000 nether_portal_building X nether_portal Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard archive_of_the_titans, battle_potion_of_intellect
0:01.276 nether_portal_active O grimoire_felguard Fluffy_Pillow 99276.0/100000: 99% mana | 5.0/5: 100% soul_shard bloodlust, nether_portal, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:02.258 nether_portal_active P summon_vilefiend Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, nether_portal, grimoire_felguard, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:03.568 nether_portal_active Q call_dreadstalkers Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, nether_portal, vilefiend, grimoire_felguard, portal_summons(2), archive_of_the_titans, battle_potion_of_intellect
0:04.878 nether_portal_active S hand_of_guldan Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(3), archive_of_the_titans, battle_potion_of_intellect
0:05.858 nether_portal_active T summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(4), archive_of_the_titans(2), battle_potion_of_intellect
0:07.167 default 9 use_items Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), archive_of_the_titans(2), battle_potion_of_intellect
0:07.167 default A berserking Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.167 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.268 nether_portal_active S hand_of_guldan Fluffy_Pillow 97106.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.095 build_a_shard K shadow_bolt Fluffy_Pillow 97933.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(5), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:10.196 nether_portal_active S hand_of_guldan Fluffy_Pillow 97034.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(5), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:11.016 build_a_shard K shadow_bolt Fluffy_Pillow 97854.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(6), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:12.111 nether_portal_active S hand_of_guldan Fluffy_Pillow 96949.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(6), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.905 build_a_shard K shadow_bolt Fluffy_Pillow 97743.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(7), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.965 nether_portal_active S hand_of_guldan Fluffy_Pillow 96803.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(7), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.762 build_a_shard K shadow_bolt Fluffy_Pillow 97600.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.823 nether_portal_active S hand_of_guldan Fluffy_Pillow 96661.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation, archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.596 build_a_shard K shadow_bolt Fluffy_Pillow 97434.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation, archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.620 nether_portal_active S hand_of_guldan Fluffy_Pillow 96458.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation, archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.507 build_a_shard K shadow_bolt Fluffy_Pillow 97345.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation, archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.687 build_a_shard K shadow_bolt Fluffy_Pillow 96525.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(2), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.827 build_a_shard K shadow_bolt Fluffy_Pillow 95665.0/100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(2), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.968 build_a_shard K shadow_bolt Fluffy_Pillow 94806.0/100000: 95% mana | 3.0/5: 60% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(2), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:23.106 build_a_shard K shadow_bolt Fluffy_Pillow 93944.0/100000: 94% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(2), archive_of_the_titans(5), ignition_mages_fuse(4)
0:24.245 default H hand_of_guldan Fluffy_Pillow 93083.0/100000: 93% mana | 5.0/5: 100% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(2), archive_of_the_titans(5), ignition_mages_fuse(5)
0:25.076 default F call_dreadstalkers Fluffy_Pillow 93914.0/100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(6), ignition_mages_fuse(5)
0:25.901 default I demonbolt Fluffy_Pillow 94739.0/100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(7), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(6), ignition_mages_fuse(5)
0:26.726 default H hand_of_guldan Fluffy_Pillow 93564.0/100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, supreme_commander, wild_imps(8), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(4), archive_of_the_titans(6), ignition_mages_fuse(5)
0:27.547 build_a_shard K shadow_bolt Fluffy_Pillow 94385.0/100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, supreme_commander, wild_imps(3), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation_final, archive_of_the_titans(6)
0:28.765 build_a_shard K shadow_bolt Fluffy_Pillow 93603.0/100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, supreme_commander, wild_imps(4), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation_final, archive_of_the_titans(6)
0:29.983 build_a_shard K shadow_bolt Fluffy_Pillow 92821.0/100000: 93% mana | 2.0/5: 40% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(4), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(6)
0:31.201 default H hand_of_guldan Fluffy_Pillow 92039.0/100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(4), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(7)
0:32.115 default I demonbolt Fluffy_Pillow 92953.0/100000: 93% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(7)
0:33.029 default I demonbolt Fluffy_Pillow 91867.0/100000: 92% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(7)
0:33.944 default H hand_of_guldan Fluffy_Pillow 90782.0/100000: 91% mana | 4.0/5: 80% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(5), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(7)
0:34.858 build_a_shard K shadow_bolt Fluffy_Pillow 91696.0/100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(5), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(7)
0:36.078 build_a_shard K shadow_bolt Fluffy_Pillow 90916.0/100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(4), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(8)
0:37.297 default H hand_of_guldan Fluffy_Pillow 90135.0/100000: 90% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core(2), demonic_calling, wild_imps(6), quick_navigation_final, archive_of_the_titans(8)
0:38.212 default I demonbolt Fluffy_Pillow 91050.0/100000: 91% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(2), demonic_calling, wild_imps(6), archive_of_the_titans(8)
0:39.195 default I demonbolt Fluffy_Pillow 90033.0/100000: 90% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, demonic_calling, wild_imps(6), archive_of_the_titans(8)
0:40.176 default H hand_of_guldan Fluffy_Pillow 89014.0/100000: 89% mana | 4.0/5: 80% soul_shard bloodlust, demonic_calling, wild_imps(7), archive_of_the_titans(9)
0:41.158 build_a_shard K shadow_bolt Fluffy_Pillow 89996.0/100000: 90% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(6), archive_of_the_titans(9)
0:42.859 build_a_shard K shadow_bolt Fluffy_Pillow 89697.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(7), archive_of_the_titans(9)
0:44.560 build_a_shard K shadow_bolt Fluffy_Pillow 89398.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), archive_of_the_titans(9)
0:46.261 default F call_dreadstalkers Fluffy_Pillow 89099.0/100000: 89% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), quick_navigation, archive_of_the_titans(10)
0:47.530 build_a_shard K shadow_bolt Fluffy_Pillow 90368.0/100000: 90% mana | 3.0/5: 60% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation, archive_of_the_titans(10)
0:49.219 default E summon_vilefiend Fluffy_Pillow 90057.0/100000: 90% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(2), overwhelming_power(25), archive_of_the_titans(10)
0:50.673 default H hand_of_guldan Fluffy_Pillow 91511.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(24), archive_of_the_titans(11)
0:51.772 build_a_shard K shadow_bolt Fluffy_Pillow 92610.0/100000: 93% mana | 0.0/5: 0% soul_shard demonic_calling, dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(23), archive_of_the_titans(11)
0:53.243 build_a_shard K shadow_bolt Fluffy_Pillow 92081.0/100000: 92% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps, dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power(21), archive_of_the_titans(11)
0:54.721 build_a_shard K shadow_bolt Fluffy_Pillow 91559.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power(20), archive_of_the_titans(11)
0:56.208 default H hand_of_guldan Fluffy_Pillow 91046.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power(18), archive_of_the_titans(12)
0:57.336 build_a_shard K shadow_bolt Fluffy_Pillow 92174.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power(17), archive_of_the_titans(12)
0:58.849 default I demonbolt Fluffy_Pillow 91687.0/100000: 92% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(5), vilefiend, quick_navigation(4), overwhelming_power(16), archive_of_the_titans(12)
0:59.985 default H hand_of_guldan Fluffy_Pillow 90823.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(6), vilefiend, quick_navigation(4), overwhelming_power(15), archive_of_the_titans(12)
1:01.127 default I demonbolt Fluffy_Pillow 91965.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(4), vilefiend, quick_navigation_final, overwhelming_power(13), archive_of_the_titans(13)
1:02.231 build_a_shard K shadow_bolt Fluffy_Pillow 91069.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), vilefiend, quick_navigation_final, overwhelming_power(12), archive_of_the_titans(13)
1:03.710 build_a_shard K shadow_bolt Fluffy_Pillow 90548.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation_final, overwhelming_power(11), archive_of_the_titans(13)
1:05.196 build_a_shard K shadow_bolt Fluffy_Pillow 90034.0/100000: 90% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation_final, overwhelming_power(9), archive_of_the_titans(14)
1:06.700 default F call_dreadstalkers Fluffy_Pillow 89538.0/100000: 90% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(3), quick_navigation_final, overwhelming_power(8), archive_of_the_titans(14)
1:07.838 default H hand_of_guldan Fluffy_Pillow 90676.0/100000: 91% mana | 4.0/5: 80% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation_final, overwhelming_power(7), archive_of_the_titans(14)
1:08.980 build_a_shard K shadow_bolt Fluffy_Pillow 91818.0/100000: 92% mana | 1.0/5: 20% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation_final, overwhelming_power(6), archive_of_the_titans(14)
1:10.511 build_a_shard K shadow_bolt Fluffy_Pillow 91349.0/100000: 91% mana | 2.0/5: 40% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation_final, overwhelming_power(4), archive_of_the_titans(15)
1:12.058 default H hand_of_guldan Fluffy_Pillow 90896.0/100000: 91% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), overwhelming_power(2), archive_of_the_titans(15)
1:13.319 build_a_shard K shadow_bolt Fluffy_Pillow 92157.0/100000: 92% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation, overwhelming_power, archive_of_the_titans(15)
1:14.997 build_a_shard K shadow_bolt Fluffy_Pillow 91835.0/100000: 92% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation, archive_of_the_titans(15)
1:16.687 build_a_shard K shadow_bolt Fluffy_Pillow 91525.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation, archive_of_the_titans(16)
1:18.376 default H hand_of_guldan Fluffy_Pillow 91214.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation, archive_of_the_titans(16)
1:19.645 default I demonbolt Fluffy_Pillow 92483.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, wild_imps(3), quick_navigation, archive_of_the_titans(16)
1:20.915 build_a_shard K shadow_bolt Fluffy_Pillow 91753.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation, archive_of_the_titans(17)
1:22.604 default H hand_of_guldan Fluffy_Pillow 91442.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation, archive_of_the_titans(17)
1:23.870 build_a_shard K shadow_bolt Fluffy_Pillow 92708.0/100000: 93% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation, archive_of_the_titans(17)
1:25.559 build_a_shard K shadow_bolt Fluffy_Pillow 92397.0/100000: 92% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation, archive_of_the_titans(18)
1:27.248 default I demonbolt Fluffy_Pillow 92086.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation, archive_of_the_titans(18)
1:28.518 default F call_dreadstalkers Fluffy_Pillow 91356.0/100000: 91% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(6), quick_navigation, archive_of_the_titans(18)
1:29.785 default H hand_of_guldan Fluffy_Pillow 92623.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation, archive_of_the_titans(18)
1:31.053 default I demonbolt Fluffy_Pillow 93891.0/100000: 94% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), quick_navigation, archive_of_the_titans(19)
1:32.321 build_a_shard K shadow_bolt Fluffy_Pillow 93159.0/100000: 93% mana | 2.0/5: 40% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation, archive_of_the_titans(19)
1:34.008 default I demonbolt Fluffy_Pillow 92846.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(19)
1:35.269 default H hand_of_guldan Fluffy_Pillow 92107.0/100000: 92% mana | 5.0/5: 100% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
1:36.529 default E summon_vilefiend Fluffy_Pillow 93367.0/100000: 93% mana | 2.0/5: 40% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
1:38.198 default G summon_demonic_tyrant Fluffy_Pillow 95036.0/100000: 95% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
1:39.867 default 8 potion Fluffy_Pillow 94705.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20)
1:39.867 build_a_shard K shadow_bolt Fluffy_Pillow 94705.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:41.538 default I demonbolt Fluffy_Pillow 94376.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_core, demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:42.790 default H hand_of_guldan Fluffy_Pillow 93628.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:44.043 build_a_shard K shadow_bolt Fluffy_Pillow 94881.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:45.712 build_a_shard K shadow_bolt Fluffy_Pillow 94550.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:47.380 build_a_shard K shadow_bolt Fluffy_Pillow 94218.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:49.040 default F call_dreadstalkers Fluffy_Pillow 93878.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:50.285 default H hand_of_guldan Fluffy_Pillow 95123.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(6), dreadstalkers(4), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:51.530 build_a_shard K shadow_bolt Fluffy_Pillow 96368.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(6), dreadstalkers(4), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:53.189 build_a_shard K shadow_bolt Fluffy_Pillow 96027.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(8), dreadstalkers(4), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:54.848 build_a_shard K shadow_bolt Fluffy_Pillow 95686.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(9), dreadstalkers(4), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:56.508 default H hand_of_guldan Fluffy_Pillow 95346.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core(3), supreme_commander, wild_imps(9), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:57.752 default I demonbolt Fluffy_Pillow 96590.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core(3), supreme_commander, wild_imps(9), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:58.998 default I demonbolt Fluffy_Pillow 95836.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core(2), supreme_commander, wild_imps(10), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:00.242 default H hand_of_guldan Fluffy_Pillow 95080.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core, supreme_commander, wild_imps(12), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:01.486 default D grimoire_felguard Fluffy_Pillow 96324.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_core(3), supreme_commander, wild_imps(10), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:02.731 default I demonbolt Fluffy_Pillow 97569.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(4), supreme_commander, wild_imps(5), vilefiend, grimoire_felguard, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:03.977 default I demonbolt Fluffy_Pillow 96815.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(3), supreme_commander, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation_final, overwhelming_power(24), archive_of_the_titans(20), battle_potion_of_intellect
2:05.020 default H hand_of_guldan Fluffy_Pillow 95858.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core(2), supreme_commander, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation_final, overwhelming_power(22), archive_of_the_titans(20)
2:06.074 default I demonbolt Fluffy_Pillow 96912.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core(2), supreme_commander, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation_final, overwhelming_power(21), archive_of_the_titans(20)
2:07.135 default I demonbolt Fluffy_Pillow 95973.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core, supreme_commander, wild_imps(3), vilefiend, grimoire_felguard, quick_navigation_final, overwhelming_power(20), archive_of_the_titans(20)
2:08.200 default H hand_of_guldan Fluffy_Pillow 95038.0/100000: 95% mana | 5.0/5: 100% soul_shard supreme_commander, wild_imps(6), grimoire_felguard, quick_navigation_final, overwhelming_power(19), archive_of_the_titans(20)
2:09.270 default F call_dreadstalkers Fluffy_Pillow 96108.0/100000: 96% mana | 2.0/5: 40% soul_shard supreme_commander, wild_imps(6), grimoire_felguard, quick_navigation_final, overwhelming_power(18), archive_of_the_titans(20)
2:10.703 build_a_shard K shadow_bolt Fluffy_Pillow 97541.0/100000: 98% mana | 0.0/5: 0% soul_shard wild_imps(4), dreadstalkers(2), grimoire_felguard, quick_navigation_final, overwhelming_power(17), archive_of_the_titans(20)
2:12.142 build_a_shard K shadow_bolt Fluffy_Pillow 96980.0/100000: 97% mana | 1.0/5: 20% soul_shard wild_imps(6), dreadstalkers(2), grimoire_felguard, quick_navigation_final, overwhelming_power(15), archive_of_the_titans(20)
2:13.598 build_a_shard K shadow_bolt Fluffy_Pillow 96436.0/100000: 96% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), grimoire_felguard, overwhelming_power(14), archive_of_the_titans(20)
2:15.163 default H hand_of_guldan Fluffy_Pillow 96001.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(4), dreadstalkers(2), grimoire_felguard, overwhelming_power(12), archive_of_the_titans(20)
2:16.350 default I demonbolt Fluffy_Pillow 97188.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), grimoire_felguard, overwhelming_power(11), archive_of_the_titans(20)
2:17.545 default I demonbolt Fluffy_Pillow 96383.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), overwhelming_power(10), archive_of_the_titans(20)
2:18.748 default H hand_of_guldan Fluffy_Pillow 95586.0/100000: 96% mana | 4.0/5: 80% soul_shard wild_imps(4), dreadstalkers(2), overwhelming_power(9), archive_of_the_titans(20)
2:19.957 default I demonbolt Fluffy_Pillow 96795.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), overwhelming_power(8), archive_of_the_titans(20)
2:21.170 build_a_shard K shadow_bolt Fluffy_Pillow 96008.0/100000: 96% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), overwhelming_power(6), archive_of_the_titans(20)
2:22.810 build_a_shard K shadow_bolt Fluffy_Pillow 95648.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(6), quick_navigation, overwhelming_power(5), archive_of_the_titans(20)
2:24.450 default E summon_vilefiend Fluffy_Pillow 95288.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_core(2), wild_imps(6), quick_navigation, overwhelming_power(3), archive_of_the_titans(20)
2:26.112 default H hand_of_guldan Fluffy_Pillow 96950.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(4), vilefiend, quick_navigation, overwhelming_power, archive_of_the_titans(20)
2:27.373 default I demonbolt Fluffy_Pillow 98211.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(3), vilefiend, quick_navigation, archive_of_the_titans(20)
2:28.641 default I demonbolt Fluffy_Pillow 97479.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(4), vilefiend, quick_navigation, archive_of_the_titans(20)
2:29.910 default H hand_of_guldan Fluffy_Pillow 96748.0/100000: 97% mana | 5.0/5: 100% soul_shard wild_imps(4), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:31.170 default F call_dreadstalkers Fluffy_Pillow 98008.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(3), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:32.850 build_a_shard K shadow_bolt Fluffy_Pillow 99688.0/100000: 100% mana | 0.0/5: 0% soul_shard wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:34.521 build_a_shard K shadow_bolt Fluffy_Pillow 98006.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:36.190 build_a_shard K shadow_bolt Fluffy_Pillow 97675.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:37.859 default H hand_of_guldan Fluffy_Pillow 97344.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:39.112 default I demonbolt Fluffy_Pillow 98597.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
2:40.356 build_a_shard K shadow_bolt Fluffy_Pillow 97841.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
2:42.015 build_a_shard K shadow_bolt Fluffy_Pillow 97500.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
2:43.675 build_a_shard K shadow_bolt Fluffy_Pillow 97160.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
2:45.334 nether_portal_building a hand_of_guldan Fluffy_Pillow 96819.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation_final, archive_of_the_titans(20)
2:46.522 build_a_shard K shadow_bolt Fluffy_Pillow 98007.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation_final, archive_of_the_titans(20)
2:48.104 build_a_shard K shadow_bolt Fluffy_Pillow 97589.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation_final, archive_of_the_titans(20)
2:49.685 build_a_shard K shadow_bolt Fluffy_Pillow 97170.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, wild_imps(3), quick_navigation_final, archive_of_the_titans(20)
2:51.269 nether_portal_building a hand_of_guldan Fluffy_Pillow 96754.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(3), demonic_calling, wild_imps(3), quick_navigation_final, archive_of_the_titans(20)
2:52.456 build_a_shard K shadow_bolt Fluffy_Pillow 97941.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, wild_imps(3), quick_navigation_final, archive_of_the_titans(20)
2:54.038 nether_portal_building Y call_dreadstalkers Fluffy_Pillow 97523.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(3), demonic_calling, wild_imps(5), quick_navigation_final, archive_of_the_titans(20)
2:55.225 build_a_shard K shadow_bolt Fluffy_Pillow 98710.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(3), wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:56.806 build_a_shard K shadow_bolt Fluffy_Pillow 98003.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(3), wild_imps(3), dreadstalkers(2), archive_of_the_titans(20)
2:58.505 build_a_shard K shadow_bolt Fluffy_Pillow 97702.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core(3), wild_imps(3), dreadstalkers(2), archive_of_the_titans(20)
3:00.206 nether_portal_building X nether_portal Fluffy_Pillow 97403.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(3), demonic_calling, wild_imps(3), dreadstalkers(2), archive_of_the_titans(20)
3:01.483 nether_portal_active S hand_of_guldan Fluffy_Pillow 98680.0/100000: 99% mana | 5.0/5: 100% soul_shard demonic_core(3), demonic_calling, nether_portal, wild_imps(3), dreadstalkers(2), portal_summons, archive_of_the_titans(20)
3:02.758 nether_portal_active S hand_of_guldan Fluffy_Pillow 99955.0/100000: 100% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, nether_portal, dreadstalkers(2), portal_summons(2), archive_of_the_titans(20)
3:04.034 nether_portal_active V demonbolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, nether_portal, wild_imps, dreadstalkers(2), portal_summons(3), archive_of_the_titans(20)
3:05.311 nether_portal_active S hand_of_guldan Fluffy_Pillow 99277.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(4), dreadstalkers(2), portal_summons(3), archive_of_the_titans(20)
3:06.588 nether_portal_active V demonbolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(4), demonic_calling, nether_portal, wild_imps(5), portal_summons(4), archive_of_the_titans(20)
3:07.867 nether_portal_active S hand_of_guldan Fluffy_Pillow 99279.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, nether_portal, wild_imps(6), portal_summons(4), archive_of_the_titans(20)
3:09.143 nether_portal_active V demonbolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, nether_portal, wild_imps(7), portal_summons(5), archive_of_the_titans(20)
3:10.419 nether_portal_active S hand_of_guldan Fluffy_Pillow 99276.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(8), portal_summons(5), archive_of_the_titans(20)
3:11.694 nether_portal_active T summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(9), portal_summons(6), quick_navigation, archive_of_the_titans(20)
3:13.382 default 9 use_items Fluffy_Pillow 98003.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(4), demonic_power, demonic_calling, nether_portal, wild_imps(8), tyrant, portal_summons(6), quick_navigation, archive_of_the_titans(20)
3:13.382 default A berserking Fluffy_Pillow 98003.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(4), demonic_power, demonic_calling, nether_portal, wild_imps(8), tyrant, portal_summons(6), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse
3:13.382 nether_portal_active V demonbolt Fluffy_Pillow 98003.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_core(4), demonic_power, demonic_calling, nether_portal, wild_imps(8), tyrant, portal_summons(6), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse
3:14.450 nether_portal_active P summon_vilefiend Fluffy_Pillow 97071.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_core(3), demonic_power, demonic_calling, nether_portal, wild_imps(6), tyrant, portal_summons(6), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse
3:15.872 nether_portal_active Q call_dreadstalkers Fluffy_Pillow 98493.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_core(3), demonic_power, demonic_calling, wild_imps(6), vilefiend, tyrant, portal_summons(6), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse
3:16.939 nether_portal_active V demonbolt Fluffy_Pillow 99560.0/100000: 100% mana | 0.0/5: 0% soul_shard berserking, demonic_core(3), demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation, overwhelming_power(24), archive_of_the_titans(20), ignition_mages_fuse
3:17.871 nether_portal_active S hand_of_guldan Fluffy_Pillow 98492.0/100000: 98% mana | 2.0/5: 40% soul_shard berserking, demonic_core(2), demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation, overwhelming_power(23), archive_of_the_titans(20), ignition_mages_fuse(2)
3:18.782 nether_portal_active V demonbolt Fluffy_Pillow 99403.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_core(2), demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation, overwhelming_power(22), archive_of_the_titans(20), ignition_mages_fuse(2)
3:19.697 nether_portal_active V demonbolt Fluffy_Pillow 98318.0/100000: 98% mana | 2.0/5: 40% soul_shard berserking, demonic_core, demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation, overwhelming_power(21), archive_of_the_titans(20), ignition_mages_fuse(2)
3:20.620 default H hand_of_guldan Fluffy_Pillow 97241.0/100000: 97% mana | 4.0/5: 80% soul_shard berserking, demonic_power, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation, overwhelming_power(20), archive_of_the_titans(20), ignition_mages_fuse(2)
3:21.546 build_a_shard K shadow_bolt Fluffy_Pillow 98167.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation, overwhelming_power(19), archive_of_the_titans(20), ignition_mages_fuse(3)
3:22.751 build_a_shard K shadow_bolt Fluffy_Pillow 97372.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_power, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation, overwhelming_power(18), archive_of_the_titans(20), ignition_mages_fuse(3)
3:23.962 default H hand_of_guldan Fluffy_Pillow 96583.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation, overwhelming_power(17), archive_of_the_titans(20), ignition_mages_fuse(3)
3:25.013 build_a_shard K shadow_bolt Fluffy_Pillow 97634.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation, overwhelming_power(15), archive_of_the_titans(20), ignition_mages_fuse(3)
3:26.428 build_a_shard K shadow_bolt Fluffy_Pillow 97049.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(12), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation(2), overwhelming_power(14), archive_of_the_titans(20), ignition_mages_fuse(4)
3:27.803 build_a_shard K shadow_bolt Fluffy_Pillow 96424.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(14), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), overwhelming_power(13), archive_of_the_titans(20), ignition_mages_fuse(4)
3:29.182 default H hand_of_guldan Fluffy_Pillow 95803.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core(3), supreme_commander, wild_imps(14), vilefiend, quick_navigation(2), overwhelming_power(11), archive_of_the_titans(20), ignition_mages_fuse(4)
3:30.230 default I demonbolt Fluffy_Pillow 96851.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core(3), supreme_commander, wild_imps(13), vilefiend, quick_navigation(2), overwhelming_power(10), archive_of_the_titans(20), ignition_mages_fuse(5)
3:31.254 default I demonbolt Fluffy_Pillow 95875.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(12), quick_navigation(2), overwhelming_power(9), archive_of_the_titans(20), ignition_mages_fuse(5)
3:32.285 build_a_shard K shadow_bolt Fluffy_Pillow 94906.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(15), quick_navigation(2), overwhelming_power(8), archive_of_the_titans(20), ignition_mages_fuse(5)
3:33.662 default H hand_of_guldan Fluffy_Pillow 94283.0/100000: 94% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(13), quick_navigation(2), overwhelming_power(7), archive_of_the_titans(20)
3:34.871 default I demonbolt Fluffy_Pillow 95492.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(7), quick_navigation(2), overwhelming_power(6), archive_of_the_titans(20)
3:36.087 default F call_dreadstalkers Fluffy_Pillow 94708.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(4), quick_navigation(2), overwhelming_power(4), archive_of_the_titans(20)
3:37.318 default H hand_of_guldan Fluffy_Pillow 95939.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core(3), supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation(2), overwhelming_power(3), archive_of_the_titans(20)
3:38.556 default I demonbolt Fluffy_Pillow 97177.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core(3), supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation(3), overwhelming_power(2), archive_of_the_titans(20)
3:39.792 default I demonbolt Fluffy_Pillow 96413.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(5), dreadstalkers(2), quick_navigation(3), overwhelming_power, archive_of_the_titans(20)
3:41.038 default H hand_of_guldan Fluffy_Pillow 95659.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation(3), overwhelming_power(23), archive_of_the_titans(20)
3:42.136 default I demonbolt Fluffy_Pillow 96757.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation(3), overwhelming_power(22), archive_of_the_titans(20)
3:43.242 default H hand_of_guldan Fluffy_Pillow 95863.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation(3), overwhelming_power(21), archive_of_the_titans(20)
3:44.353 build_a_shard K shadow_bolt Fluffy_Pillow 96974.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation(4), overwhelming_power(20), archive_of_the_titans(20)
3:45.833 build_a_shard K shadow_bolt Fluffy_Pillow 96454.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation(4), overwhelming_power(19), archive_of_the_titans(20)
3:47.320 build_a_shard K shadow_bolt Fluffy_Pillow 95941.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(8), dreadstalkers(2), quick_navigation(4), overwhelming_power(17), archive_of_the_titans(20)
3:48.824 default H hand_of_guldan Fluffy_Pillow 95445.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation(4), overwhelming_power(16), archive_of_the_titans(20)
3:49.958 default I demonbolt Fluffy_Pillow 96579.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation(4), overwhelming_power(15), archive_of_the_titans(20)
3:51.100 default I demonbolt Fluffy_Pillow 95721.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(5), quick_navigation(4), overwhelming_power(13), archive_of_the_titans(20)
3:52.255 build_a_shard K shadow_bolt Fluffy_Pillow 94876.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), quick_navigation(4), overwhelming_power(12), archive_of_the_titans(20)
3:53.803 default H hand_of_guldan Fluffy_Pillow 94424.0/100000: 94% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(4), quick_navigation_final, overwhelming_power(11), archive_of_the_titans(20)
3:54.919 build_a_shard K shadow_bolt Fluffy_Pillow 95540.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(3), quick_navigation_final, overwhelming_power(10), archive_of_the_titans(20)
3:56.415 default F call_dreadstalkers Fluffy_Pillow 95036.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), quick_navigation_final, overwhelming_power(8), archive_of_the_titans(20)
3:57.551 build_a_shard K shadow_bolt Fluffy_Pillow 96172.0/100000: 96% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(7), archive_of_the_titans(20)
3:59.070 default I demonbolt Fluffy_Pillow 95691.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(5), archive_of_the_titans(20)
4:00.225 default H hand_of_guldan Fluffy_Pillow 94846.0/100000: 95% mana | 5.0/5: 100% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation_final, overwhelming_power(4), archive_of_the_titans(20)
4:01.387 default D grimoire_felguard Fluffy_Pillow 96008.0/100000: 96% mana | 2.0/5: 40% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation_final, overwhelming_power(3), archive_of_the_titans(20)
4:02.653 default E summon_vilefiend Fluffy_Pillow 97274.0/100000: 97% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), grimoire_felguard, quick_navigation_final, overwhelming_power(2), archive_of_the_titans(20)
4:04.217 default I demonbolt Fluffy_Pillow 98838.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), vilefiend, grimoire_felguard, archive_of_the_titans(20)
4:05.493 build_a_shard K shadow_bolt Fluffy_Pillow 98114.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, grimoire_felguard, archive_of_the_titans(20)
4:07.194 default H hand_of_guldan Fluffy_Pillow 97815.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation, archive_of_the_titans(20)
4:08.461 default I demonbolt Fluffy_Pillow 99082.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(3), vilefiend, grimoire_felguard, quick_navigation, archive_of_the_titans(20)
4:09.728 default I demonbolt Fluffy_Pillow 98349.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(4), vilefiend, grimoire_felguard, quick_navigation, archive_of_the_titans(20)
4:10.997 default H hand_of_guldan Fluffy_Pillow 97618.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(5), vilefiend, grimoire_felguard, quick_navigation, archive_of_the_titans(20)
4:12.264 build_a_shard K shadow_bolt Fluffy_Pillow 98885.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(3), vilefiend, grimoire_felguard, quick_navigation(2), archive_of_the_titans(20)
4:13.945 build_a_shard K shadow_bolt Fluffy_Pillow 98006.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(5), vilefiend, grimoire_felguard, quick_navigation(2), archive_of_the_titans(20)
4:15.625 build_a_shard K shadow_bolt Fluffy_Pillow 97686.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation(2), archive_of_the_titans(20)
4:17.305 default F call_dreadstalkers Fluffy_Pillow 97366.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation(3), archive_of_the_titans(20)
4:18.556 default H hand_of_guldan Fluffy_Pillow 98617.0/100000: 99% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
4:19.808 default I demonbolt Fluffy_Pillow 99869.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
4:21.052 build_a_shard K shadow_bolt Fluffy_Pillow 99113.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
4:22.712 default H hand_of_guldan Fluffy_Pillow 98005.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
4:23.956 build_a_shard K shadow_bolt Fluffy_Pillow 99249.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
4:25.617 build_a_shard K shadow_bolt Fluffy_Pillow 98006.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:27.199 build_a_shard K shadow_bolt Fluffy_Pillow 97588.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:28.780 default H hand_of_guldan Fluffy_Pillow 97169.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:29.965 build_a_shard K shadow_bolt Fluffy_Pillow 98354.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation_final, archive_of_the_titans(20)
4:31.550 build_a_shard K shadow_bolt Fluffy_Pillow 97939.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation_final, archive_of_the_titans(20)
4:33.133 build_a_shard K shadow_bolt Fluffy_Pillow 97522.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation_final, archive_of_the_titans(20)
4:34.716 default I demonbolt Fluffy_Pillow 97105.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation_final, archive_of_the_titans(20)
4:35.902 default H hand_of_guldan Fluffy_Pillow 96291.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(3), archive_of_the_titans(20)
4:37.179 default F call_dreadstalkers Fluffy_Pillow 97568.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(3), archive_of_the_titans(20)
4:38.582 default I demonbolt Fluffy_Pillow 98971.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), archive_of_the_titans(20)
4:39.860 default H hand_of_guldan Fluffy_Pillow 98249.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), archive_of_the_titans(20)
4:41.136 build_a_shard K shadow_bolt Fluffy_Pillow 99525.0/100000: 100% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), archive_of_the_titans(20)
4:42.836 build_a_shard K shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), archive_of_the_titans(20)
4:44.535 default G summon_demonic_tyrant Fluffy_Pillow 97703.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:46.223 build_a_shard K shadow_bolt Fluffy_Pillow 97391.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), tyrant, quick_navigation, archive_of_the_titans(20)
4:47.912 build_a_shard K shadow_bolt Fluffy_Pillow 97080.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), tyrant, quick_navigation(2), archive_of_the_titans(20)
4:49.592 default E summon_vilefiend Fluffy_Pillow 96760.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), tyrant, quick_navigation(3), archive_of_the_titans(20)
4:51.261 default H hand_of_guldan Fluffy_Pillow 98429.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20)
4:52.513 build_a_shard K shadow_bolt Fluffy_Pillow 99681.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20)
4:54.183 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20)
4:55.842 build_a_shard K shadow_bolt Fluffy_Pillow 97664.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20)
4:57.505 default F call_dreadstalkers Fluffy_Pillow 97327.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20)
4:58.692 build_a_shard K shadow_bolt Fluffy_Pillow 98514.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(6), dreadstalkers(4), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 9026 8206 7205
Intellect 1467 -3 8475 7287 5476 (377)
Spirit 0 0 0 0 0
Health 180520 164120 0
Mana 100000 100000 0
Soul Shard 5 5 0
Spell Power 8475 7287 0
Crit 17.68% 17.68% 913
Haste 17.90% 17.90% 1217
Damage / Heal Versatility 1.52% 1.52% 129
ManaReg per Second 1000 1000 0
Mastery 26.55% 26.55% 742
Armor 1159 1159 1159
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Horrific Amalgam's Hood
ilevel: 390, stats: { 154 Armor, +655 Int, +1189 Sta }
azerite powers: { Supreme Commander, Overwhelming Power, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Amice of Corrupting Horror
ilevel: 390, stats: { 142 Armor, +491 Int, +892 Sta }
azerite powers: { Archive of the Titans, Heed My Call, Azerite Empowered }
Local Chest Robes of the Unraveler
ilevel: 390, stats: { 189 Armor, +655 Int, +1189 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Azerite Empowered }
Local Waist Cord of Septic Envelopment
ilevel: 385, stats: { 103 Armor, +247 Int, +417 Sta, +115 Haste, +68 Crit }
Local Legs Leggings of Lingering Infestation
ilevel: 385, stats: { 160 Armor, +329 Int, +556 Sta, +133 Haste, +112 Mastery }
Local Feet Volatile Walkers
ilevel: 385, stats: { 126 Armor, +247 Int, +417 Sta, +111 Crit, +72 Vers }
Local Wrists Void-Lashed Wristband
ilevel: 385, stats: { 80 Armor, +185 Int, +312 Sta, +81 Mastery, +57 Vers }
Local Hands Mutagenic Protofluid Handwraps
ilevel: 385, stats: { 114 Armor, +247 Int, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 370, stats: { +271 Int }
Local Trinket2 Vigilant's Bloodshaper
ilevel: 385, stats: { +313 Int }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Tusk of the Reborn Prophet
ilevel: 385, weapon: { 126 - 211, 1.8 }, stats: { +164 Int, +277 Sta, +70 Crit, +51 Haste, +792 Int }, enchant: quick_navigation
Local Off Hand Codex of Imminent Ruin
ilevel: 385, stats: { +277 Sta, +66 Haste, +56 Mastery, +503 Int }

Talents

Level
15 Dreadlash (Demonology Warlock) Demonic Strength (Demonology Warlock) Bilescourge Bombers (Demonology Warlock)
30 Demonic Calling (Demonology Warlock) Power Siphon (Demonology Warlock) Doom (Demonology Warlock)
45 Demon Skin Burning Rush Dark Pact
60 From the Shadows (Demonology Warlock) Soul Strike (Demonology Warlock) Summon Vilefiend (Demonology Warlock)
75 Darkfury Mortal Coil Demonic Circle
90 Soul Conduit (Demonology Warlock) Inner Demons (Demonology Warlock) Grimoire: Felguard (Demonology Warlock)
100 Sacrificed Souls (Demonology Warlock) Demonic Consumption (Demonology Warlock) Nether Portal (Demonology Warlock)

Profile

warlock="DL_GF_Imp"
source=default
spec=demonology
level=120
race=troll
role=spell
position=ranged_back
talents=1103033

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/inner_demons,if=talent.inner_demons.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/demonbolt

# Executed every time the actor is available.
actions=potion,if=pet.demonic_tyrant.active|target.time_to_die<30
actions+=/use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
actions+=/demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
actions+=/call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
actions+=/call_action_list,name=implosion,if=spell_targets.implosion>1
actions+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions+=/summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions+=/call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions+=/summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
actions+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
actions+=/doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
actions+=/hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
actions+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
actions+=/bilescourge_bombers
actions+=/call_action_list,name=build_a_shard

actions.build_a_shard=demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
actions.build_a_shard+=/soul_strike
actions.build_a_shard+=/shadow_bolt

actions.implosion=implosion,if=(buff.wild_imps.stack>=6&(soul_shard<3|prev_gcd.1.call_dreadstalkers|buff.wild_imps.stack>=9|prev_gcd.1.bilescourge_bombers|(!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan))&!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan&buff.demonic_power.down)|(time_to_die<3&buff.wild_imps.stack>0)|(prev_gcd.2.call_dreadstalkers&buff.wild_imps.stack>2&!talent.demonic_calling.enabled)
actions.implosion+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.implosion+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.implosion+=/summon_demonic_tyrant
actions.implosion+=/hand_of_guldan,if=soul_shard>=5
actions.implosion+=/hand_of_guldan,if=soul_shard>=3&(((prev_gcd.2.hand_of_guldan|buff.wild_imps.stack>=3)&buff.wild_imps.stack<9)|cooldown.summon_demonic_tyrant.remains<=gcd*2|buff.demonic_power.remains>gcd*2)
actions.implosion+=/demonbolt,if=prev_gcd.1.hand_of_guldan&soul_shard>=1&(buff.wild_imps.stack<=3|prev_gcd.3.hand_of_guldan)&soul_shard<4&buff.demonic_core.up
actions.implosion+=/summon_vilefiend,if=(cooldown.summon_demonic_tyrant.remains>40&spell_targets.implosion<=2)|cooldown.summon_demonic_tyrant.remains<12
actions.implosion+=/bilescourge_bombers,if=cooldown.summon_demonic_tyrant.remains>9
actions.implosion+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions.implosion+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&(buff.demonic_core.stack>=3|buff.demonic_core.remains<=gcd*5.7)
actions.implosion+=/doom,cycle_targets=1,max_cycle_targets=7,if=refreshable
actions.implosion+=/call_action_list,name=build_a_shard

actions.nether_portal=call_action_list,name=nether_portal_building,if=cooldown.nether_portal.remains<20
actions.nether_portal+=/call_action_list,name=nether_portal_active,if=cooldown.nether_portal.remains>160

actions.nether_portal_active=grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.nether_portal_active+=/summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions.nether_portal_active+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.nether_portal_active+=/call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
actions.nether_portal_active+=/hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
actions.nether_portal_active+=/demonbolt,if=buff.demonic_core.up
actions.nether_portal_active+=/call_action_list,name=build_a_shard

actions.nether_portal_building=nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
actions.nether_portal_building+=/call_dreadstalkers
actions.nether_portal_building+=/hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
actions.nether_portal_building+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
actions.nether_portal_building+=/hand_of_guldan,if=soul_shard>=5
actions.nether_portal_building+=/call_action_list,name=build_a_shard

head=horrific_amalgams_hood,id=160616,bonus_id=4824/1507/4775,azerite_powers=458/30/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536,azerite_level=33
shoulders=amice_of_corrupting_horror,id=160726,bonus_id=4824/1507/4775,azerite_powers=483/22/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=robes_of_the_unraveler,id=160614,bonus_id=4824/1507/4775,azerite_powers=483/30/13
wrists=voidlashed_wristband,id=160617,bonus_id=4800/1507
hands=mutagenic_protofluid_handwraps,id=160715,bonus_id=4800/1507
waist=cord_of_septic_envelopment,id=160727,bonus_id=4800/1507
legs=leggings_of_lingering_infestation,id=160615,bonus_id=4800/1507
feet=volatile_walkers,id=160714,bonus_id=4800/1507
finger1=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=ignition_mages_fuse,id=159615,bonus_id=1542/4779
trinket2=vigilants_bloodshaper,id=160651,bonus_id=4800/1507
main_hand=tusk_of_the_reborn_prophet,id=160691,bonus_id=4800/1507,enchant=quick_navigation
off_hand=codex_of_imminent_ruin,id=160696,bonus_id=4800/1507

# Gear Summary
# gear_ilvl=385.25
# gear_stamina=7205
# gear_intellect=5476
# gear_crit_rating=913
# gear_haste_rating=1217
# gear_mastery_rating=742
# gear_versatility_rating=129
# gear_armor=1159
default_pet=Imp

DL_ID_Felguard : 16699 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
16698.5 16698.5 15.0 / 0.090% 2096.3 / 12.6% 4.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
971.1 961.6 Mana 0.00% 47.4 100.0% 100%
Talents
  • 15: Dreadlash (Demonology Warlock)
  • 30: Demonic Calling (Demonology Warlock)
  • 60: Summon Vilefiend (Demonology Warlock)
  • 90: Inner Demons (Demonology Warlock)
  • 100: Nether Portal (Demonology Warlock)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
DL_ID_Felguard 16699
Demonbolt 1333 8.0% 47.0 5.82sec 8516 7495 Direct 47.8 7114 14229 8369 17.6%  

Stats details: demonbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.97 47.80 0.00 0.00 1.1361 0.0000 399994.41 399994.41 0.00 7495.30 7495.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.37 82.37% 7114.22 6520 8308 7115.53 6895 7339 280072 280072 0.00
crit 8.43 17.63% 14228.84 13040 16616 14230.11 0 16616 119923 119923 0.00
 
 

Action details: demonbolt

Static Values
  • id:264178
  • school:shadowflame
  • resource:mana
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:264178
  • name:Demonbolt
  • school:shadowflame
  • tooltip:
  • description:Send the fiery soul of a fallen demon at the enemy, causing {$s1=0} Shadowflame damage.$?c2[ |cFFFFFFFFGenerates 2 Soul Shards.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.667000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Hand of Gul'dan 1099 6.6% 62.9 4.72sec 5242 4750 Direct 62.7 4465 8910 5253 17.7%  

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.88 62.75 0.00 0.00 1.1035 0.0000 329630.83 329630.83 0.00 4750.20 4750.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.62 82.27% 4465.38 1634 5979 4459.62 4006 4851 230509 230509 0.00
crit 11.12 17.73% 8910.04 3267 11958 8898.15 5805 10900 99122 99122 0.00
 
 

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadowflame
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.7000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:2.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadowflame
  • tooltip:
  • description:Calls down a demonic meteor full of Wild Imps which burst forth to attack the target. Deals up to ${$m1*$86040m1} Shadowflame damage on impact to all enemies within $86040A1 yds of the target{$?s196283=false}[, applies Doom to each target,][] and summons up to ${$m1*{$104317m2=0}} Wild Imps, based on Soul Shards consumed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.160000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Heed My Call 141 (201) 0.8% (1.2%) 7.3 36.60sec 8272 0 Direct 7.3 4925 9849 5794 17.7%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.30 7.30 0.00 0.00 0.0000 0.0000 42268.60 42268.60 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.01 82.34% 4924.62 4925 4925 4923.64 0 4925 29582 29582 0.00
crit 1.29 17.66% 9849.24 9849 9849 7211.09 0 9849 12686 12686 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4620.00
  • base_dd_max:4620.00
 
    Heed My Call (_aoe) 60 0.4% 7.3 36.60sec 2478 0 Direct 7.3 2111 4221 2478 17.4%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.30 7.30 0.00 0.00 0.0000 0.0000 18077.54 18077.54 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.02 82.59% 2110.55 2111 2111 2110.13 0 2111 12716 12716 0.00
crit 1.27 17.41% 4221.10 4221 4221 3065.98 0 4221 5362 5362 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1980.00
  • base_dd_max:1980.00
 
Shadow Bolt 1317 7.9% 94.1 3.13sec 4197 2813 Direct 93.4 3593 7185 4228 17.7%  

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.11 93.43 0.00 0.00 1.4917 0.0000 394979.40 394979.40 0.00 2813.46 2813.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.92 82.33% 3593.22 3335 4297 3593.81 3547 3649 276400 276400 0.00
crit 16.50 17.67% 7184.62 6670 8595 7185.43 6936 7659 118579 118579 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=0} Shadow damage.$?c2[ |cFFFFFFFFGenerates 1 Soul Shard.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.345000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Volatile Blood Explosion 288 1.7% 7.3 36.98sec 11896 0 Direct 7.2 10240 20481 12061 17.8%  

Stats details: volatile_blood_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.25 7.15 0.00 0.00 0.0000 0.0000 86284.77 86284.77 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.88 82.23% 10240.44 10240 10240 10236.34 0 10240 60240 60240 0.00
crit 1.27 17.77% 20480.88 20481 20481 14990.91 0 20481 26045 26045 0.00
 
 

Action details: volatile_blood_explosion

Static Values
  • id:278057
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278057
  • name:Volatile Blood Explosion
  • school:shadow
  • tooltip:
  • description:Your damaging spells have a chance to launch an orb of charged blood at your target, dealing {$s1=4788} Shadow damage split among all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9607.38
  • base_dd_max:9607.38
 
pet - felguard 2637 / 2637
Felstorm 379 2.3% 10.4 30.14sec 10921 2907 Periodic 62.1 1556 3111 1831 17.7% 13.0%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.41 0.00 62.10 62.10 3.7567 0.6300 113739.99 162604.98 30.05 2907.17 2907.17
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.1 82.30% 1556.23 1454 1910 1556.25 1522 1602 79545 113719 30.05
crit 11.0 17.70% 3111.19 2908 3820 3111.35 2940 3420 34195 48886 30.05
 
 

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $ Physical damage every $t1 sec. Unable to use other abilities.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc89751=The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Legion Strike 1061 6.4% 58.4 5.09sec 5440 5416 Direct 58.4 4626 9252 5440 17.6%  

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.43 58.43 0.00 0.00 1.0045 0.0000 317856.20 454413.62 30.05 5415.66 5415.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.15 82.41% 4626.49 4179 5592 4627.21 4507 4748 222782 318493 30.05
crit 10.28 17.59% 9251.59 8359 11183 9252.79 8467 10314 95074 135920 30.05
 
 

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy>=100
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w2%.
  • description:A strong attack that deals $<damage> damage to all enemies in front of it, and reduces the effectiveness of any healing the victim receives by {$s2=10}% for {$d=6 seconds}. |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1197 7.2% 173.7 1.71sec 2066 1394 Direct 173.7 1755 3510 2066 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 173.69 173.69 0.00 0.00 1.4824 0.0000 358796.15 512942.18 30.05 1393.51 1393.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 142.95 82.30% 1755.15 1586 2122 1755.40 1728 1786 250896 358687 30.05
crit 30.74 17.70% 3510.35 3173 4245 3510.68 3299 3719 107900 154256 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - vicious_hellhound 1048 / 159
Demon Fangs 648 0.6% 10.5 12.80sec 2792 2792 Direct 10.5 2374 4748 2792 17.6%  

Stats details: demon_fangs

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.48 10.48 0.00 0.00 1.0000 0.0000 29258.22 29258.22 0.00 2792.35 2792.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.63 82.40% 2374.40 2026 2711 2367.66 0 2711 20503 20503 0.00
crit 1.84 17.60% 4748.09 4053 5422 3704.63 0 5422 8755 8755 0.00
 
 

Action details: demon_fangs

Static Values
  • id:272013
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272013
  • name:Demon Fangs
  • school:shadowflame
  • tooltip:
  • description:The Vicious Hellhound chomps at its target, dealing Shadowflame damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 400 0.4% 92.0 1.41sec 195 320 Direct 92.0 165 331 195 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.95 91.95 0.00 0.00 0.6091 0.0000 17900.47 25590.87 30.05 319.59 319.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.63 82.25% 165.33 141 188 165.05 142 184 12504 17876 30.05
crit 16.32 17.75% 330.64 281 376 328.73 0 369 5397 7715 29.92
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - illidari_satyr 1241 / 190
melee 407 0.4% 47.5 2.81sec 388 325 Direct 47.5 330 659 388 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.54 47.54 0.00 0.00 1.1932 0.0000 18440.33 26362.66 30.05 325.11 325.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.17 82.40% 329.93 281 376 329.54 283 370 12925 18478 30.05
crit 8.37 17.60% 659.33 562 753 648.49 0 753 5516 7885 29.58
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 203 0.2% 47.5 2.81sec 194 154 Direct 47.5 165 330 194 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.54 47.54 0.00 0.00 1.2628 0.0000 9225.02 13188.28 30.05 153.67 153.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.15 82.35% 164.96 141 188 164.78 142 185 6458 9232 30.05
crit 8.39 17.65% 329.74 281 376 325.57 0 376 2767 3956 29.71
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Shadow Slash 631 0.6% 10.3 13.31sec 2795 2795 Direct 10.3 2376 4754 2795 17.6%  

Stats details: shadow_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.29 10.29 0.00 0.00 1.0000 0.0000 28747.78 28747.78 0.00 2794.85 2794.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.48 82.40% 2376.26 2026 2711 2369.28 0 2679 20142 20142 0.00
crit 1.81 17.60% 4753.79 4053 5422 3761.96 0 5422 8605 8605 0.00
 
 

Action details: shadow_slash

Static Values
  • id:272012
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272012
  • name:Shadow Slash
  • school:shadow
  • tooltip:
  • description:The Satyr strikes at out with its weapons, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - vilefiend 3122 / 1561
Bile Spit 1094 3.3% 6.8 47.17sec 23918 0 Direct 6.8 8823 17638 10360 17.4%  
Periodic 33.5 2777 0 2777 0.0% 22.3%

Stats details: bile_spit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.84 6.83 33.46 33.46 0.0000 2.0000 163643.40 163643.40 0.00 2445.65 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.64 82.56% 8823.01 8474 10104 8823.31 8630 9560 49741 49741 0.00
crit 1.19 17.44% 17637.75 16947 20207 12754.19 0 20207 21004 21004 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.5 100.00% 2776.73 2502 3310 2777.05 2622 2868 92898 92898 0.00
 
 

Action details: bile_spit

Static Values
  • id:267997
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:65.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267997
  • name:Bile Spit
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:The Vilefiend spits a ball of bile at its target, dealing ${$m1*$<demoMastery>} Nature damage and an additional ${$m2*$<demoMastery>} Nature damage every $t2 sec for {$d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.680000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.200000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Headbutt 733 2.2% 30.1 9.80sec 3649 3649 Direct 30.1 3100 6200 3649 17.7%  

Stats details: headbutt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.12 30.12 0.00 0.00 1.0000 0.0000 109915.50 157137.40 30.05 3649.01 3649.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.79 82.28% 3099.67 2737 3621 3100.37 2933 3221 76825 109831 30.05
crit 5.34 17.72% 6199.52 5474 7243 6178.68 0 7243 33090 47306 29.95
 
 

Action details: headbutt

Static Values
  • id:267999
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267999
  • name:Headbutt
  • school:physical
  • tooltip:
  • description:The Vilefiend rams its bladed head into the target, dealing {$s1=0} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1295 3.9% 108.0 2.71sec 1796 1340 Direct 108.0 1526 3051 1796 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.00 108.00 0.00 0.00 1.3403 0.0000 193968.19 277300.81 30.05 1339.96 1339.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.86 82.28% 1525.56 1337 1775 1525.92 1463 1572 135566 193807 30.05
crit 19.14 17.72% 3051.48 2673 3550 3051.93 2808 3298 58403 83494 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - bilescourge 3803 / 574
Toxic Bile 3803 3.4% 60.6 2.07sec 2804 2971 Direct 60.6 2383 4766 2805 17.7%  

Stats details: toxic_bile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.61 60.58 0.00 0.00 0.9437 0.0000 169916.86 169916.86 0.00 2970.83 2970.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.85 82.29% 2382.89 2026 2711 2376.99 0 2652 118789 118789 0.00
crit 10.73 17.71% 4765.50 4053 5422 4727.13 0 5422 51128 51128 0.00
 
 

Action details: toxic_bile

Static Values
  • id:272167
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272167
  • name:Toxic Bile
  • school:nature
  • tooltip:
  • description:The Bilescourge spits wads of Toxic Bile at its target, dealing Nature damage.
 
pet - dreadstalker 3639 / 2400
Dreadbite 1334 5.3% 29.0 21.04sec 9078 0 Direct 29.0 7719 15435 9078 17.6%  

Stats details: dreadbite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.04 29.04 0.00 0.00 0.0000 0.0000 263660.57 263660.57 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.93 82.39% 7719.31 7139 9517 7719.71 7462 7943 184723 184723 0.00
crit 5.11 17.61% 15434.91 14278 19033 15385.61 0 19033 78937 78937 0.00
 
 

Action details: dreadbite

Static Values
  • id:205196
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205196
  • name:Dreadbite
  • school:shadow
  • tooltip:
  • description:Bite the target, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 2305 9.1% 311.9 1.90sec 1462 1106 Direct 311.9 1243 2485 1462 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 311.88 311.88 0.00 0.00 1.3214 0.0000 455881.10 651736.78 30.05 1106.17 1106.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 256.87 82.36% 1242.62 1105 1473 1242.79 1225 1262 319198 456331 30.05
crit 55.00 17.64% 2485.04 2211 2947 2485.36 2375 2602 136683 195405 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.83
 
pet - wild_imp 3112 / 3042
Fel Firebolt 3112 18.2% 1216.7 0.24sec 750 508 Direct 1211.8 640 1279 753 17.7%  

Stats details: fel_firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1216.74 1211.78 0.00 0.00 1.4766 0.0000 912149.47 912149.47 0.00 507.70 507.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 997.47 82.31% 639.61 569 761 639.69 630 650 637991 637991 0.00
crit 214.30 17.69% 1279.30 1138 1523 1279.47 1246 1315 274158 274158 0.00
 
 

Action details: fel_firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Fel Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.046000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - darkhound 1278 / 195
Fel Bite 462 0.4% 10.0 12.93sec 2089 2089 Direct 10.0 1779 3557 2089 17.4%  

Stats details: fel_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.01 10.01 0.00 0.00 1.0000 0.0000 20917.05 29903.44 30.05 2088.99 2088.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.27 82.56% 1778.76 1519 2032 1772.72 0 2032 14704 21022 29.95
crit 1.75 17.44% 3557.12 3037 4064 2717.95 0 4064 6213 8882 22.98
 
 

Action details: fel_bite

Static Values
  • id:272435
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272435
  • name:Fel Bite
  • school:physical
  • tooltip:
  • description:The Darkhound bites its target, causing serious Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 816 0.7% 47.3 2.67sec 776 650 Direct 47.3 659 1318 776 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.28 47.28 0.00 0.00 1.1943 0.0000 36691.61 52455.07 30.05 649.77 649.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.91 82.30% 659.31 562 753 658.23 570 742 25656 36678 30.05
crit 8.37 17.70% 1318.35 1125 1505 1301.03 0 1505 11036 15777 29.69
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - demonic_tyrant 4677 / 823
Demonfire 4677 4.9% 37.7 6.87sec 6536 4906 Direct 37.6 5561 11128 6549 17.8%  

Stats details: demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.67 37.59 0.00 0.00 1.3322 0.0000 246221.68 246221.68 0.00 4905.89 4905.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.92 82.24% 5560.81 5029 5917 5564.17 5472 5677 171921 171921 0.00
crit 6.68 17.76% 11127.51 10059 11834 11128.13 0 11834 74300 74300 0.00
 
 

Action details: demonfire

Static Values
  • id:270481
  • school:shadowflame
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:270481
  • name:Demonfire
  • school:shadowflame
  • tooltip:
  • description:Deal {$s1=0} Shadowflame damage to your enemy target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.357500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - void_terror 1797 / 274
Double Breath 0 (149) 0.0% (0.9%) 0.0 0.00sec 0 7319

Stats details: double_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 7319.25 7319.25
 
 

Action details: double_breath

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (1) 489 0.4% 8.0 17.10sec 2788 0 Direct 8.0 2367 4739 2788 17.8%  

Stats details: double_breath1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.95 7.95 0.00 0.00 0.0000 0.0000 22172.17 22172.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.54 82.24% 2366.98 2026 2711 2360.05 0 2711 15480 15480 0.00
crit 1.41 17.76% 4738.88 4053 5422 3440.59 0 5422 6692 6692 0.00
 
 

Action details: double_breath1

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (2) 488 0.4% 8.0 17.10sec 2786 0 Direct 8.0 2368 4732 2786 17.7%  

Stats details: double_breath2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.95 7.95 0.00 0.00 0.0000 0.0000 22153.23 22153.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.55 82.32% 2367.69 2026 2711 2360.66 0 2668 15499 15499 0.00
crit 1.41 17.68% 4732.35 4053 5422 3354.01 0 5422 6655 6655 0.00
 
 

Action details: double_breath2

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
melee 821 0.7% 47.7 2.69sec 776 650 Direct 47.7 660 1319 776 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.71 47.71 0.00 0.00 1.1934 0.0000 37038.64 52951.19 30.05 650.49 650.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.27 82.31% 659.71 562 753 658.89 569 742 25909 37040 30.05
crit 8.44 17.69% 1319.00 1125 1505 1303.65 0 1505 11129 15911 29.74
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - urzul 1311 / 197
Many Faced Bite 493 0.4% 10.5 12.07sec 2088 2088 Direct 10.5 1777 3556 2088 17.5%  

Stats details: many_faced_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.54 10.54 0.00 0.00 1.0000 0.0000 22006.58 31461.05 30.05 2088.31 2088.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.69 82.51% 1777.07 1519 2032 1771.78 0 2032 15450 22088 29.98
crit 1.84 17.49% 3556.22 3037 4064 2798.15 0 4064 6556 9373 23.64
 
 

Action details: many_faced_bite

Static Values
  • id:272439
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272439
  • name:Many Faced Bite
  • school:physical
  • tooltip:
  • description:The Ur'zul rears up and bites its target, dealing Physical damage. You're not sure which face actually bit you after thinking about it.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 817 0.7% 46.9 2.63sec 776 650 Direct 46.9 660 1319 776 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.90 46.90 0.00 0.00 1.1931 0.0000 36369.13 51994.03 30.05 650.05 650.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.64 82.41% 659.50 562 753 658.57 569 737 25486 36436 30.05
crit 8.25 17.59% 1319.03 1125 1505 1299.57 0 1505 10883 15558 29.65
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - shivarra 1883 / 285
melee 810 0.7% 46.8 2.76sec 775 649 Direct 46.8 659 1319 775 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.77 46.77 0.00 0.00 1.1952 0.0000 36252.14 51826.79 30.05 648.56 648.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.53 82.39% 659.06 562 753 658.03 569 747 25396 36306 30.05
crit 8.23 17.61% 1318.56 1125 1505 1302.15 0 1505 10856 15521 29.71
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 405 0.4% 46.8 2.76sec 388 306 Direct 46.8 330 659 388 17.6%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.77 46.77 0.00 0.00 1.2652 0.0000 18127.65 25915.65 30.05 306.38 306.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.52 82.37% 329.57 281 376 329.08 285 370 12696 18151 30.05
crit 8.24 17.63% 658.91 562 753 648.45 0 753 5431 7765 29.61
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Multi-Slash 0 (101) 0.0% (0.6%) 0.0 0.00sec 0 3924

Stats details: multislash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 3924.42 3924.42
 
 

Action details: multislash

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (1) 167 0.2% 7.7 18.08sec 982 0 Direct 7.7 835 1668 982 17.7%  

Stats details: multislash1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.65 7.65 0.00 0.00 0.0000 0.0000 7514.12 10742.33 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.30 82.35% 834.78 717 959 830.90 0 944 5261 7521 29.93
crit 1.35 17.65% 1668.28 1434 1919 1176.54 0 1919 2253 3222 21.17
 
 

Action details: multislash1

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (2) 167 0.2% 7.7 18.08sec 981 0 Direct 7.7 835 1668 981 17.5%  

Stats details: multislash2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.65 7.65 0.00 0.00 0.0000 0.0000 7505.62 10730.18 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.31 82.48% 834.81 717 959 830.85 0 959 5269 7533 29.91
crit 1.34 17.52% 1667.98 1434 1919 1179.33 0 1919 2236 3197 21.24
 
 

Action details: multislash2

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (3) 167 0.1% 7.7 18.08sec 979 0 Direct 7.7 835 1670 979 17.3%  

Stats details: multislash3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.65 7.65 0.00 0.00 0.0000 0.0000 7490.84 10709.05 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.33 82.73% 834.58 717 959 831.40 0 944 5284 7554 29.95
crit 1.32 17.27% 1670.14 1434 1919 1170.77 0 1919 2207 3155 21.08
 
 

Action details: multislash3

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (4) 167 0.2% 7.7 18.08sec 983 0 Direct 7.7 835 1669 983 17.7%  

Stats details: multislash4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.65 7.65 0.00 0.00 0.0000 0.0000 7519.07 10749.41 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.30 82.28% 834.72 717 959 831.40 0 959 5256 7514 29.95
crit 1.36 17.72% 1668.82 1434 1919 1170.49 0 1919 2263 3236 21.07
 
 

Action details: multislash4

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - wrathguard 1684 / 255
melee 815 0.7% 47.1 2.71sec 776 652 Direct 47.1 660 1319 776 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.05 47.05 0.00 0.00 1.1899 0.0000 36525.11 52217.03 30.05 652.36 652.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.73 82.32% 659.60 562 753 658.56 570 753 25550 36526 30.05
crit 8.32 17.68% 1319.48 1125 1505 1299.79 0 1505 10976 15691 29.63
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 408 0.4% 47.1 2.71sec 388 308 Direct 47.1 330 660 388 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.05 47.05 0.00 0.00 1.2589 0.0000 18271.56 26121.38 30.05 308.46 308.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.71 82.26% 329.80 281 376 329.29 285 376 12766 18250 30.05
crit 8.34 17.74% 659.76 562 753 650.81 0 753 5506 7871 29.69
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Overhead Assault 461 0.4% 9.9 13.23sec 2095 2095 Direct 9.9 1780 3554 2095 17.7%  

Stats details: overhead_assault

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.93 9.93 0.00 0.00 1.0000 0.0000 20793.41 29726.68 30.05 2094.63 2094.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.17 82.25% 1779.63 1519 2032 1776.41 0 2032 14532 20776 30.00
crit 1.76 17.75% 3553.95 3037 4064 2757.92 0 4064 6261 8951 23.34
 
 

Action details: overhead_assault

Static Values
  • id:272432
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272432
  • name:Overhead Assault
  • school:physical
  • tooltip:
  • description:The Wrathguard smashes its target with a heavy overhand swing.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - prince_malchezaar 4525 / 390
melee 3014 1.5% 20.9 1.45sec 3679 3054 Direct 20.9 3123 6243 3679 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.94 20.94 0.00 0.00 1.2047 0.0000 77056.23 110161.13 30.05 3054.15 3054.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.21 82.18% 3123.46 2665 3566 3113.90 2696 3490 53759 76855 30.05
crit 3.73 17.82% 6242.75 5330 7131 5975.35 0 7131 23297 33306 28.82
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 1511 0.8% 20.9 1.45sec 1839 1441 Direct 20.9 1561 3127 1839 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.94 20.94 0.00 0.00 1.2758 0.0000 38514.05 55060.45 30.05 1441.45 1441.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.23 82.26% 1561.12 1333 1783 1556.69 1350 1759 26894 38448 30.05
crit 3.72 17.74% 3126.99 2665 3566 2979.55 0 3566 11620 16613 28.74
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - eye_of_guldan 969 / 82
Eye of Gul'dan 969 0.5% 28.3 5.01sec 860 1125 Periodic 61.0 399 0 399 0.0% 59.8%

Stats details: eye_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.28 0.00 60.96 60.96 0.7645 2.9406 24329.79 24329.79 0.00 121.11 1125.49
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.0 100.00% 399.08 119 484 397.06 0 430 24330 24330 0.00
 
 

Action details: eye_of_guldan

Static Values
  • id:272131
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272131
  • name:Eye of Gul'dan
  • school:shadowflame
  • tooltip:Suffering Shadow damage every $t1 sec.
  • description:The Eye of Gul'dan stares deep into the target's soul, causing Shadow Damage every $t1 sec for {$d=15 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.300000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
DL_ID_Felguard
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_ID_Felguard
  • harmful:false
  • if_expr:
 
Berserking 2.0 186.90sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:pet.demonic_tyrant.active|target.time_to_die<=15
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Call Dreadstalkers 14.6 21.04sec

Stats details: call_dreadstalkers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.58 0.00 0.00 0.00 1.2034 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: call_dreadstalkers

Static Values
  • id:104316
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:20.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
Spelldata
  • id:104316
  • name:Call Dreadstalkers
  • school:shadow
  • tooltip:
  • description:Summons {$s1=2} ferocious Dreadstalkers to attack the target for {$193332d=12 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_ID_Felguard
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_ID_Felguard
  • harmful:false
  • if_expr:
 
inner_demons 1.0 0.00sec

Stats details: inner_demons

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: inner_demons

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.inner_demons.enabled
 
Nether Portal 2.0 0.00sec

Stats details: nether_portal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.2381 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: nether_portal

Static Values
  • id:267217
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Spelldata
  • id:267217
  • name:Nether Portal
  • school:shadow
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Summon Demonic Tyrant 3.6 93.53sec

Stats details: summon_demonic_tyrant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.58 0.00 0.00 0.00 1.5065 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_demonic_tyrant

Static Values
  • id:265187
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
Spelldata
  • id:265187
  • name:Summon Demonic Tyrant
  • school:shadow
  • tooltip:
  • description:Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.
 
Summon Felguard 1.0 0.00sec

Stats details: summon_felguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_felguard

Static Values
  • id:30146
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:30146
  • name:Summon Felguard
  • school:shadow
  • tooltip:
  • description:Summons a Felguard under your command as a powerful melee combatant.
 
summon_random_demon 17.8 14.57sec

Stats details: summon_random_demon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.78 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_random_demon

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
 
Summon Vilefiend 6.8 47.17sec

Stats details: summon_vilefiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.84 0.00 0.00 0.00 1.5519 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_vilefiend

Static Values
  • id:264119
  • school:fire
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Spelldata
  • id:264119
  • name:Summon Vilefiend
  • school:fire
  • tooltip:
  • description:Summon a Vilefiend to fight for you for the next {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:28.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=7}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 100.9sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 186.9sec 186.9sec 6.76% 8.37% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Demonic Calling 12.8 15.6 23.2sec 10.1sec 52.29% 83.64% 15.6(15.6) 0.1

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_calling_1:52.29%

Trigger Attempt Success

  • trigger_pct:19.98%

Spelldata details

  • id:205146
  • name:Demonic Calling
  • tooltip:Your next Call Dreadstalkers costs {$205145s1=1} less Soul Shard and has no cast time.
  • description:{$@spelldesc205145=Shadow Bolt{$?s264178=true}[ and Demonbolt have][ has] a {$h=20}% chance to make your next Call Dreadstalkers cost {$s1=1} less Soul Shard and have no cast time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Demonic Core 24.4 32.1 11.7sec 5.0sec 40.22% 100.00% 4.8(4.8) 0.4

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_demonic_core
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_core_1:16.42%
  • demonic_core_2:15.91%
  • demonic_core_3:5.39%
  • demonic_core_4:2.49%

Trigger Attempt Success

  • trigger_pct:23.54%

Spelldata details

  • id:264173
  • name:Demonic Core
  • tooltip:The cast time of Demonbolt is reduced by {$s1=100}%.
  • description:{$@spelldesc267102=When your Wild Imps expend all of their energy or are imploded, you have a {$s1=10}% chance to absorb their life essence, granting you a stack of Demonic Core. When your summoned Dreadstalkers fade away, you have a {$s2=100}% chance to absorb their life essence, granting you a stack of Demonic Core. Demonic Core reduces the cast time of Demonbolt by {$264173s1=100}%. Maximum {$264173u=4} stacks.}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Demonic Power 3.6 0.0 93.5sec 93.5sec 17.60% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_demonic_power
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_power_1:17.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:265273
  • name:Demonic Power
  • tooltip:Damage dealt by your demons increased by {$s2=15}%.
  • description:{$@spelldesc265187=Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
dreadstalkers 11.6 17.6 26.7sec 10.1sec 65.94% 0.00% 0.0(0.0) 10.9

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_dreadstalkers
  • max_stacks:4
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • dreadstalkers_2:59.58%
  • dreadstalkers_4:6.36%

Trigger Attempt Success

  • trigger_pct:100.00%
eyes_of_guldan 0.2 0.5 162.6sec 2.0sec 1.37% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_eyes_of_guldan
  • max_stacks:4
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • eyes_of_guldan_4:1.38%

Trigger Attempt Success

  • trigger_pct:100.00%
Ignition Mage's Fuse 2.4 0.0 171.7sec 171.7sec 14.83% 0.00% 2.0(2.0) 2.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:275.80

Stack Uptimes

  • ignition_mages_fuse_1:3.12%
  • ignition_mages_fuse_2:3.08%
  • ignition_mages_fuse_3:3.04%
  • ignition_mages_fuse_4:2.88%
  • ignition_mages_fuse_5:2.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Nether Portal 2.0 0.0 182.8sec 0.0sec 10.14% 17.95% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_nether_portal
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • nether_portal_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267217
  • name:Nether Portal
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Overwhelming Power 4.3 3.0 66.9sec 36.4sec 44.30% 0.00% 3.0(42.3) 0.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • overwhelming_power_1:1.30%
  • overwhelming_power_2:1.34%
  • overwhelming_power_3:1.37%
  • overwhelming_power_4:1.40%
  • overwhelming_power_5:1.44%
  • overwhelming_power_6:1.48%
  • overwhelming_power_7:1.52%
  • overwhelming_power_8:1.55%
  • overwhelming_power_9:1.60%
  • overwhelming_power_10:1.64%
  • overwhelming_power_11:1.68%
  • overwhelming_power_12:1.73%
  • overwhelming_power_13:1.78%
  • overwhelming_power_14:1.83%
  • overwhelming_power_15:1.88%
  • overwhelming_power_16:1.93%
  • overwhelming_power_17:1.99%
  • overwhelming_power_18:2.04%
  • overwhelming_power_19:2.10%
  • overwhelming_power_20:2.17%
  • overwhelming_power_21:2.23%
  • overwhelming_power_22:2.30%
  • overwhelming_power_23:2.37%
  • overwhelming_power_24:2.43%
  • overwhelming_power_25:1.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
portal_summons 2.0 13.3 182.8sec 14.5sec 19.51% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_portal_summons
  • max_stacks:40
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • portal_summons_1:1.70%
  • portal_summons_2:0.78%
  • portal_summons_3:1.24%
  • portal_summons_4:1.54%
  • portal_summons_5:1.85%
  • portal_summons_6:1.85%
  • portal_summons_7:3.97%
  • portal_summons_8:5.82%
  • portal_summons_9:0.78%

Trigger Attempt Success

  • trigger_pct:100.00%
prince_malchezaar 0.2 0.0 161.1sec 89.8sec 1.41% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_prince_malchezaar
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • prince_malchezaar_1:1.41%

Trigger Attempt Success

  • trigger_pct:100.00%
Quick Navigation 6.0 22.4 52.3sec 10.3sec 67.59% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:17.55%
  • quick_navigation_2:17.13%
  • quick_navigation_3:16.75%
  • quick_navigation_4:16.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.3 0.0 52.3sec 52.3sec 17.50% 0.00% 0.0(0.0) 5.2

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:17.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Supreme Commander 4.3 0.1 82.5sec 79.9sec 17.00% 0.00% 0.1(0.1) 3.3

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_supreme_commander
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:838.00

Stack Uptimes

  • supreme_commander_1:17.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279878
  • name:Supreme Commander
  • tooltip:
  • description:When your Demonic Tyrant expires, consume its life essence, granting you a stack of Demonic Core and increasing your Intellect by {$s1=398} for {$279885d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tyrant 3.6 0.0 93.5sec 93.5sec 17.60% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_tyrant
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • tyrant_1:17.60%

Trigger Attempt Success

  • trigger_pct:100.00%
vilefiend 6.8 0.0 47.2sec 47.2sec 50.03% 0.00% 0.0(0.0) 6.4

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_vilefiend
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vilefiend_1:50.03%

Trigger Attempt Success

  • trigger_pct:100.00%
wild_imps 2.0 188.1 131.8sec 0.0sec 97.77% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_wild_imps
  • max_stacks:40
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • wild_imps_1:1.41%
  • wild_imps_2:2.05%
  • wild_imps_3:10.37%
  • wild_imps_4:20.95%
  • wild_imps_5:8.12%
  • wild_imps_6:14.85%
  • wild_imps_7:18.54%
  • wild_imps_8:5.07%
  • wild_imps_9:3.53%
  • wild_imps_10:3.97%
  • wild_imps_11:4.18%
  • wild_imps_12:1.70%
  • wild_imps_13:1.20%
  • wild_imps_14:1.25%
  • wild_imps_15:0.35%
  • wild_imps_16:0.15%
  • wild_imps_17:0.06%
  • wild_imps_18:0.01%
  • wild_imps_19:0.00%
  • wild_imps_20:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Inner Demons

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_inner_demons
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:12.00

Stack Uptimes

  • inner_demons_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267216
  • name:Inner Demons
  • tooltip:
  • description:You passively summon a Wild Imp to fight for you every $t1 sec, and have a {$s1=10}% chance to also summon an additional Demon to fight for you for {$s2=15} sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
summon_random_demon 17.8 13.9sec
one_shard_hog 9.0 21.8sec
two_shard_hog 4.2 49.1sec
three_shard_hog 49.7 5.6sec
portal_summon 15.3 13.7sec

Resources

Resource Usage Type Count Total Average RPE APR
DL_ID_Felguard
call_dreadstalkers Soul Shard 14.6 16.9 1.2 1.2 0.0
demonbolt Mana 48.0 95950.4 2000.0 2042.8 4.2
hand_of_guldan Soul Shard 62.9 166.5 2.6 2.6 1979.4
shadow_bolt Mana 94.1 188212.7 2000.0 1999.9 2.1
summon_demonic_tyrant Mana 3.6 7156.9 2000.0 2000.2 0.0
summon_vilefiend Soul Shard 6.8 6.8 1.0 1.0 0.0
pet - felguard
felstorm Energy 10.4 624.8 60.0 60.0 182.0
legion_strike Energy 58.4 3505.8 60.0 60.0 90.7
pet - wild_imp
fel_firebolt Energy 1216.7 18638.9 15.3 15.3 48.9
Resource Gains Type Count Total Average Overflow
demonbolt Soul Shard 47.98 95.81 (50.45%) 2.00 0.14 0.15%
shadow_bolt Soul Shard 94.11 94.10 (49.55%) 1.00 0.01 0.01%
mana_regen Mana 557.86 288456.74 (100.00%) 517.08 10998.53 3.67%
pet - felguard
energy_regen Energy 375.71 3990.42 (100.00%) 10.62 18.58 0.46%
pet - bilescourge
energy_regen Energy 9.78 0.00 (0.00%) 0.00 134.78 100.00%
pet - demonic_tyrant
energy_regen Energy 37.68 0.00 (0.00%) 0.00 760.43 100.00%
pet - bilescourge
energy_regen Energy 12.24 0.00 (0.00%) 0.00 169.60 100.00%
pet - bilescourge
energy_regen Energy 14.01 0.00 (0.00%) 0.00 193.73 100.00%
pet - bilescourge
energy_regen Energy 13.37 0.00 (0.00%) 0.00 184.78 100.00%
pet - bilescourge
energy_regen Energy 4.18 0.00 (0.00%) 0.00 57.65 100.00%
pet - bilescourge
energy_regen Energy 2.80 0.00 (0.00%) 0.00 38.40 100.00%
pet - bilescourge
energy_regen Energy 3.15 0.00 (0.00%) 0.00 43.69 100.00%
Resource RPS-Gain RPS-Loss
Mana 961.57 971.11
Soul Shard 0.63 0.63
Combat End Resource Mean Min Max
Mana 97122.33 91052.00 100000.00
Soul Shard 2.60 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.1%

Statistics & Data Analysis

Fight Length
Sample Data DL_ID_Felguard Fight Length
Count 4999
Mean 299.99
Minimum 240.01
Maximum 359.96
Spread ( max - min ) 119.95
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data DL_ID_Felguard Damage Per Second
Count 4999
Mean 16698.55
Minimum 14885.36
Maximum 19313.00
Spread ( max - min ) 4427.63
Range [ ( max - min ) / 2 * 100% ] 13.26%
Standard Deviation 540.4627
5th Percentile 15896.95
95th Percentile 17670.00
( 95th Percentile - 5th Percentile ) 1773.05
Mean Distribution
Standard Deviation 7.6441
95.00% Confidence Intervall ( 16683.56 - 16713.53 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4025
0.1 Scale Factor Error with Delta=300 2494
0.05 Scale Factor Error with Delta=300 9975
0.01 Scale Factor Error with Delta=300 249354
Priority Target DPS
Sample Data DL_ID_Felguard Priority Target Damage Per Second
Count 4999
Mean 16698.55
Minimum 14885.36
Maximum 19313.00
Spread ( max - min ) 4427.63
Range [ ( max - min ) / 2 * 100% ] 13.26%
Standard Deviation 540.4627
5th Percentile 15896.95
95th Percentile 17670.00
( 95th Percentile - 5th Percentile ) 1773.05
Mean Distribution
Standard Deviation 7.6441
95.00% Confidence Intervall ( 16683.56 - 16713.53 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4025
0.1 Scale Factor Error with Delta=300 2494
0.05 Scale Factor Error with Delta=300 9975
0.01 Scale Factor Error with Delta=300 249354
DPS(e)
Sample Data DL_ID_Felguard Damage Per Second (Effective)
Count 4999
Mean 16698.55
Minimum 14885.36
Maximum 19313.00
Spread ( max - min ) 4427.63
Range [ ( max - min ) / 2 * 100% ] 13.26%
Damage
Sample Data DL_ID_Felguard Damage
Count 4999
Mean 1271235.56
Minimum 891300.49
Maximum 1696013.96
Spread ( max - min ) 804713.47
Range [ ( max - min ) / 2 * 100% ] 31.65%
DTPS
Sample Data DL_ID_Felguard Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data DL_ID_Felguard Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data DL_ID_Felguard Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data DL_ID_Felguard Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data DL_ID_Felguard Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data DL_ID_Felguard Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data DL_ID_FelguardTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data DL_ID_Felguard Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 inner_demons,if=talent.inner_demons.enabled
5 0.00 snapshot_stats
6 0.00 potion
7 0.00 demonbolt
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,if=pet.demonic_tyrant.active|target.time_to_die<30
9 2.37 use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
A 2.00 berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
0.00 demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
B 0.00 call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
C 0.00 call_action_list,name=implosion,if=spell_targets.implosion>1
0.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
D 4.87 summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
E 11.56 call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
F 1.59 summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
0.00 doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
G 46.22 hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
0.00 soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
H 42.88 demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
0.00 bilescourge_bombers
I 0.00 call_action_list,name=build_a_shard
actions.build_a_shard
# count action,conditions
0.00 demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
0.00 soul_strike
J 94.61 shadow_bolt
actions.nether_portal_active
# count action,conditions
0.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
N 2.00 summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
O 2.00 call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
P 0.00 call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
Q 14.42 hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
R 1.96 summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
S 0.04 summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
T 4.10 demonbolt,if=buff.demonic_core.up
U 0.00 call_action_list,name=build_a_shard
actions.nether_portal_building
# count action,conditions
V 2.00 nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
W 1.03 call_dreadstalkers
X 0.55 hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
Y 1.92 hand_of_guldan,if=soul_shard>=5
Z 0.00 call_action_list,name=build_a_shard

Sample Sequence

0123467VNOQJQR9AJQJQJQJQJQJQJJJJJEGHGJJJGHHGHGHHGHGHHJGEHHDGHGHJGHHGJJJEGHJGHHGJJGJJJJJGEHHGHDGF8HJGJJJJEGJJHGHGHJGHHJGHEGHJGJJJDHGHHGJEJGJHGHJJJYJJJYWJJJJYJJJVQQTNOR9ATQTQTQTQJJJGJJHEJGJJJGHHGJHGHJJGEJJDJGJJJGHHJGHEJGJJJGJJJGJJHJEGHGJJDFJJGJJJE

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask DL_ID_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food DL_ID_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 augmentation DL_ID_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_felguard Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 4 inner_demons Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 potion Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard battle_potion_of_intellect
0:00.000 precombat 7 demonbolt Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard battle_potion_of_intellect
0:00.000 nether_portal_building V nether_portal Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard archive_of_the_titans, battle_potion_of_intellect
0:01.278 nether_portal_active N summon_vilefiend Fluffy_Pillow 99278.0/100000: 99% mana | 5.0/5: 100% soul_shard bloodlust, nether_portal, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:02.586 nether_portal_active O call_dreadstalkers Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, nether_portal, vilefiend, portal_summons(2), archive_of_the_titans, battle_potion_of_intellect
0:03.893 nether_portal_active Q hand_of_guldan Fluffy_Pillow 100000.0/100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, portal_summons(3), archive_of_the_titans, battle_potion_of_intellect
0:04.875 build_a_shard J shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, portal_summons(4), overwhelming_power(25), archive_of_the_titans, battle_potion_of_intellect
0:06.007 nether_portal_active Q hand_of_guldan Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard bloodlust, nether_portal, wild_imps, dreadstalkers(2), vilefiend, portal_summons(4), overwhelming_power(23), archive_of_the_titans(2), battle_potion_of_intellect
0:06.867 nether_portal_active R summon_demonic_tyrant Fluffy_Pillow 98864.0/100000: 99% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, portal_summons(5), overwhelming_power(23), archive_of_the_titans(2), battle_potion_of_intellect
0:08.013 default 9 use_items Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), overwhelming_power(21), archive_of_the_titans(2), battle_potion_of_intellect
0:08.013 default A berserking Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), overwhelming_power(21), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.013 build_a_shard J shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), overwhelming_power(21), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.991 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96983.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), overwhelming_power(21), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.745 build_a_shard J shadow_bolt Fluffy_Pillow 97737.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), overwhelming_power(20), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:10.727 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96719.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), overwhelming_power(19), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:11.481 build_a_shard J shadow_bolt Fluffy_Pillow 97473.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), overwhelming_power(18), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:12.476 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96468.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), overwhelming_power(17), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.230 build_a_shard J shadow_bolt Fluffy_Pillow 97222.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), overwhelming_power(16), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.206 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96198.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), overwhelming_power(15), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.962 build_a_shard J shadow_bolt Fluffy_Pillow 96954.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(9), overwhelming_power(15), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.943 nether_portal_active Q hand_of_guldan Fluffy_Pillow 95935.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(9), overwhelming_power(14), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.697 build_a_shard J shadow_bolt Fluffy_Pillow 96689.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(9), overwhelming_power(13), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.661 nether_portal_active Q hand_of_guldan Fluffy_Pillow 95653.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(9), overwhelming_power(12), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.415 build_a_shard J shadow_bolt Fluffy_Pillow 96407.0/100000: 96% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(9), overwhelming_power(11), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.532 build_a_shard J shadow_bolt Fluffy_Pillow 95524.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(9), overwhelming_power(10), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:20.655 build_a_shard J shadow_bolt Fluffy_Pillow 94647.0/100000: 95% mana | 2.0/5: 40% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(9), overwhelming_power(9), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.753 build_a_shard J shadow_bolt Fluffy_Pillow 93745.0/100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(9), overwhelming_power(8), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.856 build_a_shard J shadow_bolt Fluffy_Pillow 92848.0/100000: 93% mana | 4.0/5: 80% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(9), quick_navigation, overwhelming_power(7), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:23.959 default E call_dreadstalkers Fluffy_Pillow 91951.0/100000: 92% mana | 5.0/5: 100% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(10), dreadstalkers(2), vilefiend, portal_summons(9), quick_navigation, overwhelming_power(6), archive_of_the_titans(5), ignition_mages_fuse(4)
0:24.793 default G hand_of_guldan Fluffy_Pillow 92785.0/100000: 93% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, portal_summons(9), quick_navigation, overwhelming_power(5), archive_of_the_titans(5), ignition_mages_fuse(5)
0:25.606 default H demonbolt Fluffy_Pillow 93598.0/100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, portal_summons(9), quick_navigation, overwhelming_power(25), archive_of_the_titans(6), ignition_mages_fuse(5)
0:26.360 default G hand_of_guldan Fluffy_Pillow 92352.0/100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, portal_summons(9), quick_navigation, overwhelming_power(24), archive_of_the_titans(6), ignition_mages_fuse(5)
0:27.115 build_a_shard J shadow_bolt Fluffy_Pillow 93107.0/100000: 93% mana | 0.0/5: 0% soul_shard bloodlust, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, portal_summons(9), quick_navigation(2), overwhelming_power(23), archive_of_the_titans(6), ignition_mages_fuse(5)
0:28.101 build_a_shard J shadow_bolt Fluffy_Pillow 92093.0/100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, supreme_commander, wild_imps(4), dreadstalkers(4), vilefiend, portal_summons(9), quick_navigation(2), overwhelming_power(22), archive_of_the_titans(6)
0:29.242 build_a_shard J shadow_bolt Fluffy_Pillow 91234.0/100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(4), vilefiend, portal_summons(9), quick_navigation(2), overwhelming_power(21), archive_of_the_titans(6)
0:30.387 default G hand_of_guldan Fluffy_Pillow 90379.0/100000: 90% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(4), vilefiend, quick_navigation(3), overwhelming_power(20), archive_of_the_titans(7)
0:31.247 default H demonbolt Fluffy_Pillow 91239.0/100000: 91% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(3), demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(19), archive_of_the_titans(7)
0:32.104 default H demonbolt Fluffy_Pillow 90096.0/100000: 90% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(18), archive_of_the_titans(7)
0:32.968 default G hand_of_guldan Fluffy_Pillow 88960.0/100000: 89% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation(4), overwhelming_power(18), archive_of_the_titans(7)
0:33.835 default H demonbolt Fluffy_Pillow 89827.0/100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(17), archive_of_the_titans(7)
0:34.667 default G hand_of_guldan Fluffy_Pillow 88659.0/100000: 89% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(16), archive_of_the_titans(7)
0:35.505 default H demonbolt Fluffy_Pillow 89497.0/100000: 89% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(5), dreadstalkers(2), quick_navigation_final, overwhelming_power(15), archive_of_the_titans(8)
0:36.348 default H demonbolt Fluffy_Pillow 88340.0/100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core(3), demonic_calling, supreme_commander, wild_imps(7), quick_navigation_final, overwhelming_power(14), archive_of_the_titans(8)
0:37.194 default G hand_of_guldan Fluffy_Pillow 87186.0/100000: 87% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(9), quick_navigation_final, overwhelming_power(13), archive_of_the_titans(8)
0:38.045 default H demonbolt Fluffy_Pillow 88037.0/100000: 88% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core(3), demonic_calling, wild_imps(9), quick_navigation_final, overwhelming_power(12), archive_of_the_titans(8)
0:38.901 default G hand_of_guldan Fluffy_Pillow 86893.0/100000: 87% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core(4), demonic_calling, wild_imps(7), quick_navigation_final, overwhelming_power(12), archive_of_the_titans(8)
0:39.756 default H demonbolt Fluffy_Pillow 87748.0/100000: 88% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(4), demonic_calling, wild_imps(9), quick_navigation_final, overwhelming_power(11), archive_of_the_titans(8)
0:40.614 default H demonbolt Fluffy_Pillow 86606.0/100000: 87% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core(4), demonic_calling, wild_imps(9), quick_navigation_final, overwhelming_power(10), archive_of_the_titans(9)
0:41.478 build_a_shard J shadow_bolt Fluffy_Pillow 85470.0/100000: 85% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, wild_imps(9), quick_navigation_final, overwhelming_power(9), archive_of_the_titans(9)
0:42.981 default G hand_of_guldan Fluffy_Pillow 84973.0/100000: 85% mana | 5.0/5: 100% soul_shard demonic_core(3), demonic_calling, wild_imps(8), quick_navigation_final, overwhelming_power(8), archive_of_the_titans(9)
0:44.118 default E call_dreadstalkers Fluffy_Pillow 86110.0/100000: 86% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, wild_imps(6), overwhelming_power(6), archive_of_the_titans(9)
0:45.347 default H demonbolt Fluffy_Pillow 87339.0/100000: 87% mana | 1.0/5: 20% soul_shard demonic_core(3), wild_imps(7), dreadstalkers(2), overwhelming_power(5), archive_of_the_titans(10)
0:46.585 default H demonbolt Fluffy_Pillow 86577.0/100000: 87% mana | 3.0/5: 60% soul_shard demonic_core(3), wild_imps(7), dreadstalkers(2), overwhelming_power(4), archive_of_the_titans(10)
0:47.830 default D summon_vilefiend Fluffy_Pillow 85822.0/100000: 86% mana | 5.0/5: 100% soul_shard demonic_core(2), wild_imps(6), dreadstalkers(2), overwhelming_power(3), archive_of_the_titans(10)
0:49.501 default G hand_of_guldan Fluffy_Pillow 87493.0/100000: 87% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(5), dreadstalkers(2), vilefiend, overwhelming_power, archive_of_the_titans(10)
0:50.768 default H demonbolt Fluffy_Pillow 88760.0/100000: 89% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(4), dreadstalkers(2), vilefiend, archive_of_the_titans(11)
0:52.045 default G hand_of_guldan Fluffy_Pillow 88037.0/100000: 88% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(5), dreadstalkers(2), vilefiend, archive_of_the_titans(11)
0:53.319 default H demonbolt Fluffy_Pillow 89311.0/100000: 89% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(7), dreadstalkers(2), vilefiend, overwhelming_power(25), archive_of_the_titans(11)
0:54.424 build_a_shard J shadow_bolt Fluffy_Pillow 88416.0/100000: 88% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, overwhelming_power(24), archive_of_the_titans(11)
0:55.903 default G hand_of_guldan Fluffy_Pillow 87895.0/100000: 88% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, overwhelming_power(23), archive_of_the_titans(12)
0:57.020 default H demonbolt Fluffy_Pillow 89012.0/100000: 89% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(6), vilefiend, quick_navigation, overwhelming_power(21), archive_of_the_titans(12)
0:58.142 default H demonbolt Fluffy_Pillow 88134.0/100000: 88% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(7), vilefiend, quick_navigation, overwhelming_power(20), archive_of_the_titans(12)
0:59.270 default G hand_of_guldan Fluffy_Pillow 87262.0/100000: 87% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(9), vilefiend, quick_navigation, overwhelming_power(19), archive_of_the_titans(12)
1:00.405 build_a_shard J shadow_bolt Fluffy_Pillow 88397.0/100000: 88% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(7), vilefiend, quick_navigation, overwhelming_power(18), archive_of_the_titans(13)
1:01.926 build_a_shard J shadow_bolt Fluffy_Pillow 87918.0/100000: 88% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(8), vilefiend, quick_navigation(2), overwhelming_power(17), archive_of_the_titans(13)
1:03.447 build_a_shard J shadow_bolt Fluffy_Pillow 87439.0/100000: 87% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), vilefiend, quick_navigation(2), overwhelming_power(15), archive_of_the_titans(13)
1:04.986 default E call_dreadstalkers Fluffy_Pillow 86978.0/100000: 87% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), quick_navigation(2), overwhelming_power(14), archive_of_the_titans(13)
1:06.146 default G hand_of_guldan Fluffy_Pillow 88138.0/100000: 88% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(6), dreadstalkers(2), quick_navigation(2), overwhelming_power(12), archive_of_the_titans(14)
1:07.321 default H demonbolt Fluffy_Pillow 89313.0/100000: 89% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation(2), overwhelming_power(11), archive_of_the_titans(14)
1:08.502 build_a_shard J shadow_bolt Fluffy_Pillow 88494.0/100000: 88% mana | 2.0/5: 40% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(2), overwhelming_power(10), archive_of_the_titans(14)
1:10.087 default G hand_of_guldan Fluffy_Pillow 88079.0/100000: 88% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation(2), overwhelming_power(8), archive_of_the_titans(15)
1:11.290 default H demonbolt Fluffy_Pillow 89282.0/100000: 89% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation(2), overwhelming_power(7), archive_of_the_titans(15)
1:12.498 default H demonbolt Fluffy_Pillow 88490.0/100000: 88% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(5), dreadstalkers(2), quick_navigation(2), overwhelming_power(6), archive_of_the_titans(15)
1:13.713 default G hand_of_guldan Fluffy_Pillow 87705.0/100000: 88% mana | 4.0/5: 80% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation(2), overwhelming_power(5), archive_of_the_titans(15)
1:14.936 build_a_shard J shadow_bolt Fluffy_Pillow 88928.0/100000: 89% mana | 1.0/5: 20% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation(2), overwhelming_power(4), archive_of_the_titans(15)
1:16.575 build_a_shard J shadow_bolt Fluffy_Pillow 88567.0/100000: 89% mana | 2.0/5: 40% soul_shard wild_imps(8), dreadstalkers(2), quick_navigation(2), overwhelming_power(2), archive_of_the_titans(16)
1:18.234 default G hand_of_guldan Fluffy_Pillow 88226.0/100000: 88% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(7), quick_navigation(2), archive_of_the_titans(16)
1:19.494 build_a_shard J shadow_bolt Fluffy_Pillow 89486.0/100000: 89% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(7), quick_navigation(2), archive_of_the_titans(16)
1:21.175 build_a_shard J shadow_bolt Fluffy_Pillow 89167.0/100000: 89% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(6), quick_navigation(2), archive_of_the_titans(17)
1:22.856 build_a_shard J shadow_bolt Fluffy_Pillow 88848.0/100000: 89% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation(2), archive_of_the_titans(17)
1:24.537 build_a_shard J shadow_bolt Fluffy_Pillow 88529.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation(3), archive_of_the_titans(17)
1:26.207 build_a_shard J shadow_bolt Fluffy_Pillow 88199.0/100000: 88% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, wild_imps(4), quick_navigation(3), archive_of_the_titans(18)
1:27.878 default G hand_of_guldan Fluffy_Pillow 87870.0/100000: 88% mana | 5.0/5: 100% soul_shard demonic_core(3), demonic_calling, wild_imps(4), quick_navigation(3), archive_of_the_titans(18)
1:29.130 default E call_dreadstalkers Fluffy_Pillow 89122.0/100000: 89% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, wild_imps(3), quick_navigation(4), archive_of_the_titans(18)
1:30.376 default H demonbolt Fluffy_Pillow 90368.0/100000: 90% mana | 1.0/5: 20% soul_shard demonic_core(3), wild_imps(2), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(19)
1:31.621 default H demonbolt Fluffy_Pillow 89613.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(4), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(19)
1:32.865 default G hand_of_guldan Fluffy_Pillow 88857.0/100000: 89% mana | 5.0/5: 100% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(19)
1:34.110 default H demonbolt Fluffy_Pillow 90102.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(19)
1:35.298 default D summon_vilefiend Fluffy_Pillow 89290.0/100000: 89% mana | 4.0/5: 80% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
1:36.881 default G hand_of_guldan Fluffy_Pillow 90873.0/100000: 91% mana | 3.0/5: 60% soul_shard wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
1:38.068 default F summon_demonic_tyrant Fluffy_Pillow 92060.0/100000: 92% mana | 0.0/5: 0% soul_shard wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
1:39.650 default 8 potion Fluffy_Pillow 91642.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_core, demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20)
1:39.650 default H demonbolt Fluffy_Pillow 91642.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_core, demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:40.839 build_a_shard J shadow_bolt Fluffy_Pillow 90831.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:42.422 default G hand_of_guldan Fluffy_Pillow 90414.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(25), archive_of_the_titans(20), battle_potion_of_intellect
1:43.461 build_a_shard J shadow_bolt Fluffy_Pillow 91453.0/100000: 91% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(24), archive_of_the_titans(20), battle_potion_of_intellect
1:44.851 build_a_shard J shadow_bolt Fluffy_Pillow 90843.0/100000: 91% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, overwhelming_power(23), archive_of_the_titans(20), battle_potion_of_intellect
1:46.339 build_a_shard J shadow_bolt Fluffy_Pillow 90331.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, quick_navigation, overwhelming_power(21), archive_of_the_titans(20), battle_potion_of_intellect
1:47.833 build_a_shard J shadow_bolt Fluffy_Pillow 89825.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, quick_navigation, overwhelming_power(20), archive_of_the_titans(20), battle_potion_of_intellect
1:49.338 default E call_dreadstalkers Fluffy_Pillow 89330.0/100000: 89% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, quick_navigation, overwhelming_power(18), archive_of_the_titans(20), battle_potion_of_intellect
1:50.479 default G hand_of_guldan Fluffy_Pillow 90471.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(11), dreadstalkers(4), vilefiend, tyrant, quick_navigation, overwhelming_power(17), archive_of_the_titans(20), battle_potion_of_intellect
1:51.627 build_a_shard J shadow_bolt Fluffy_Pillow 91619.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(11), dreadstalkers(4), vilefiend, tyrant, quick_navigation, overwhelming_power(16), archive_of_the_titans(20), battle_potion_of_intellect
1:53.163 build_a_shard J shadow_bolt Fluffy_Pillow 91155.0/100000: 91% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(13), dreadstalkers(4), vilefiend, tyrant, quick_navigation, overwhelming_power(14), archive_of_the_titans(20), battle_potion_of_intellect
1:54.719 default H demonbolt Fluffy_Pillow 90711.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_core, supreme_commander, wild_imps(14), dreadstalkers(4), vilefiend, quick_navigation, overwhelming_power(13), archive_of_the_titans(20), battle_potion_of_intellect
1:55.894 default G hand_of_guldan Fluffy_Pillow 89886.0/100000: 90% mana | 4.0/5: 80% soul_shard supreme_commander, wild_imps(14), dreadstalkers(4), vilefiend, quick_navigation, overwhelming_power(12), archive_of_the_titans(20), battle_potion_of_intellect
1:57.074 default H demonbolt Fluffy_Pillow 91066.0/100000: 91% mana | 1.0/5: 20% soul_shard demonic_core(2), supreme_commander, wild_imps(14), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(10), archive_of_the_titans(20), battle_potion_of_intellect
1:58.268 default G hand_of_guldan Fluffy_Pillow 90260.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_core, supreme_commander, wild_imps(14), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(9), archive_of_the_titans(20), battle_potion_of_intellect
1:59.469 default H demonbolt Fluffy_Pillow 91461.0/100000: 91% mana | 0.0/5: 0% soul_shard demonic_core, supreme_commander, wild_imps(13), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(8), archive_of_the_titans(20), battle_potion_of_intellect
2:00.677 build_a_shard J shadow_bolt Fluffy_Pillow 90669.0/100000: 91% mana | 2.0/5: 40% soul_shard supreme_commander, wild_imps(14), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(7), archive_of_the_titans(20), battle_potion_of_intellect
2:02.294 default G hand_of_guldan Fluffy_Pillow 90286.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_core(3), supreme_commander, wild_imps(11), vilefiend, quick_navigation, overwhelming_power(5), archive_of_the_titans(20), battle_potion_of_intellect
2:03.523 default H demonbolt Fluffy_Pillow 91515.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_core(3), supreme_commander, wild_imps(7), vilefiend, quick_navigation, overwhelming_power(4), archive_of_the_titans(20), battle_potion_of_intellect
2:04.760 default H demonbolt Fluffy_Pillow 90752.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_core(2), supreme_commander, wild_imps(8), vilefiend, quick_navigation, overwhelming_power(3), archive_of_the_titans(20)
2:06.007 build_a_shard J shadow_bolt Fluffy_Pillow 89999.0/100000: 90% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(10), vilefiend, quick_navigation(2), overwhelming_power, archive_of_the_titans(20)
2:07.677 default G hand_of_guldan Fluffy_Pillow 89669.0/100000: 90% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(7), quick_navigation(2), archive_of_the_titans(20)
2:08.937 default H demonbolt Fluffy_Pillow 90929.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(5), quick_navigation(2), archive_of_the_titans(20)
2:10.198 default E call_dreadstalkers Fluffy_Pillow 90190.0/100000: 90% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(4), quick_navigation(2), archive_of_the_titans(20)
2:11.460 default G hand_of_guldan Fluffy_Pillow 91452.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(6), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:12.722 default H demonbolt Fluffy_Pillow 92714.0/100000: 93% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(7), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:13.983 build_a_shard J shadow_bolt Fluffy_Pillow 91975.0/100000: 92% mana | 2.0/5: 40% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:15.662 default G hand_of_guldan Fluffy_Pillow 91654.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:16.923 build_a_shard J shadow_bolt Fluffy_Pillow 92915.0/100000: 93% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:18.602 build_a_shard J shadow_bolt Fluffy_Pillow 92594.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(8), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:20.279 build_a_shard J shadow_bolt Fluffy_Pillow 92271.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:21.961 default D summon_vilefiend Fluffy_Pillow 91953.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:23.641 default H demonbolt Fluffy_Pillow 93633.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, wild_imps(3), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:24.901 default G hand_of_guldan Fluffy_Pillow 92893.0/100000: 93% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(4), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:26.162 default H demonbolt Fluffy_Pillow 94154.0/100000: 94% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(4), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:27.415 default H demonbolt Fluffy_Pillow 93407.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:28.669 default G hand_of_guldan Fluffy_Pillow 92661.0/100000: 93% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(4), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:29.923 build_a_shard J shadow_bolt Fluffy_Pillow 93915.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:31.593 default E call_dreadstalkers Fluffy_Pillow 93585.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:32.844 build_a_shard J shadow_bolt Fluffy_Pillow 94836.0/100000: 95% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:34.512 default G hand_of_guldan Fluffy_Pillow 94504.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(25), archive_of_the_titans(20)
2:35.593 build_a_shard J shadow_bolt Fluffy_Pillow 95585.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(24), archive_of_the_titans(20)
2:36.983 default H demonbolt Fluffy_Pillow 94975.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(23), archive_of_the_titans(20)
2:38.032 default G hand_of_guldan Fluffy_Pillow 94024.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(21), archive_of_the_titans(20)
2:39.092 default H demonbolt Fluffy_Pillow 95084.0/100000: 95% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation_final, overwhelming_power(20), archive_of_the_titans(20)
2:40.157 build_a_shard J shadow_bolt Fluffy_Pillow 94149.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(19), archive_of_the_titans(20)
2:41.583 build_a_shard J shadow_bolt Fluffy_Pillow 93575.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation_final, overwhelming_power(18), archive_of_the_titans(20)
2:43.017 build_a_shard J shadow_bolt Fluffy_Pillow 93009.0/100000: 93% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation_final, overwhelming_power(16), archive_of_the_titans(20)
2:44.464 nether_portal_building Y hand_of_guldan Fluffy_Pillow 92456.0/100000: 92% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation_final, overwhelming_power(15), archive_of_the_titans(20)
2:45.555 build_a_shard J shadow_bolt Fluffy_Pillow 93547.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation_final, overwhelming_power(14), archive_of_the_titans(20)
2:47.018 build_a_shard J shadow_bolt Fluffy_Pillow 93010.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(4), overwhelming_power(12), archive_of_the_titans(20)
2:48.601 build_a_shard J shadow_bolt Fluffy_Pillow 92593.0/100000: 93% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, wild_imps(4), overwhelming_power(11), archive_of_the_titans(20)
2:50.194 nether_portal_building Y hand_of_guldan Fluffy_Pillow 92186.0/100000: 92% mana | 5.0/5: 100% soul_shard demonic_core(3), demonic_calling, wild_imps(4), overwhelming_power(9), archive_of_the_titans(20)
2:51.403 nether_portal_building W call_dreadstalkers Fluffy_Pillow 93395.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, wild_imps(4), overwhelming_power(8), archive_of_the_titans(20)
2:52.808 build_a_shard J shadow_bolt Fluffy_Pillow 94800.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_core(3), wild_imps(6), dreadstalkers(2), overwhelming_power(7), archive_of_the_titans(20)
2:54.439 build_a_shard J shadow_bolt Fluffy_Pillow 94431.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_core(3), wild_imps(7), dreadstalkers(2), overwhelming_power(5), archive_of_the_titans(20)
2:56.089 build_a_shard J shadow_bolt Fluffy_Pillow 94081.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_core(3), demonic_calling, wild_imps(3), dreadstalkers(2), overwhelming_power(3), archive_of_the_titans(20)
2:57.758 build_a_shard J shadow_bolt Fluffy_Pillow 93750.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, wild_imps(3), dreadstalkers(2), overwhelming_power(2), archive_of_the_titans(20)
2:59.438 nether_portal_building Y hand_of_guldan Fluffy_Pillow 93430.0/100000: 93% mana | 5.0/5: 100% soul_shard demonic_core(3), demonic_calling, wild_imps(3), dreadstalkers(2), archive_of_the_titans(20)
3:00.713 build_a_shard J shadow_bolt Fluffy_Pillow 94705.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, wild_imps(4), dreadstalkers(2), archive_of_the_titans(20)
3:02.412 build_a_shard J shadow_bolt Fluffy_Pillow 94404.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_core(3), demonic_calling, wild_imps(3), dreadstalkers(2), archive_of_the_titans(20)
3:04.114 build_a_shard J shadow_bolt Fluffy_Pillow 94106.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_core(4), demonic_calling, wild_imps(4), archive_of_the_titans(20)
3:05.817 nether_portal_building V nether_portal Fluffy_Pillow 93809.0/100000: 94% mana | 5.0/5: 100% soul_shard demonic_core(4), demonic_calling, wild_imps(4), archive_of_the_titans(20)
3:07.094 nether_portal_active Q hand_of_guldan Fluffy_Pillow 95086.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_core(4), demonic_calling, nether_portal, wild_imps(4), portal_summons, archive_of_the_titans(20)
3:08.369 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96361.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core(4), demonic_calling, nether_portal, wild_imps(4), portal_summons(2), quick_navigation, archive_of_the_titans(20)
3:09.635 nether_portal_active T demonbolt Fluffy_Pillow 97627.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(4), demonic_calling, nether_portal, wild_imps(4), portal_summons(3), quick_navigation, archive_of_the_titans(20)
3:10.902 nether_portal_active N summon_vilefiend Fluffy_Pillow 96894.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, nether_portal, wild_imps(5), portal_summons(3), quick_navigation, archive_of_the_titans(20)
3:12.592 nether_portal_active O call_dreadstalkers Fluffy_Pillow 98584.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core(4), demonic_calling, nether_portal, wild_imps(6), vilefiend, portal_summons(4), quick_navigation, archive_of_the_titans(20)
3:13.860 nether_portal_active R summon_demonic_tyrant Fluffy_Pillow 99852.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(4), nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, portal_summons(5), quick_navigation, archive_of_the_titans(20)
3:15.551 default 9 use_items Fluffy_Pillow 98006.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(4), demonic_power, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation, archive_of_the_titans(20)
3:15.551 default A berserking Fluffy_Pillow 98006.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(4), demonic_power, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse
3:15.551 nether_portal_active T demonbolt Fluffy_Pillow 98006.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_core(4), demonic_power, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse
3:16.618 nether_portal_active Q hand_of_guldan Fluffy_Pillow 97073.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_core(3), demonic_power, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse
3:17.687 nether_portal_active T demonbolt Fluffy_Pillow 98142.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_core(3), demonic_power, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse
3:18.756 nether_portal_active Q hand_of_guldan Fluffy_Pillow 97211.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_core(2), demonic_power, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse
3:19.824 nether_portal_active T demonbolt Fluffy_Pillow 98279.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_core(2), demonic_power, nether_portal, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse(2)
3:20.851 nether_portal_active Q hand_of_guldan Fluffy_Pillow 97306.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_core, demonic_power, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse(2)
3:21.881 nether_portal_active T demonbolt Fluffy_Pillow 98336.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_core, demonic_power, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse(2)
3:22.909 nether_portal_active Q hand_of_guldan Fluffy_Pillow 97364.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_power, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse(2)
3:23.936 build_a_shard J shadow_bolt Fluffy_Pillow 98391.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_power, wild_imps(12), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse(3)
3:25.256 build_a_shard J shadow_bolt Fluffy_Pillow 97711.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, wild_imps(14), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), overwhelming_power(25), archive_of_the_titans(20), ignition_mages_fuse(3)
3:26.409 build_a_shard J shadow_bolt Fluffy_Pillow 96864.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(15), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), overwhelming_power(24), archive_of_the_titans(20), ignition_mages_fuse(3)
3:27.740 default G hand_of_guldan Fluffy_Pillow 96195.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(15), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), overwhelming_power(23), archive_of_the_titans(20), ignition_mages_fuse(4)
3:28.719 build_a_shard J shadow_bolt Fluffy_Pillow 97174.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(15), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), overwhelming_power(22), archive_of_the_titans(20), ignition_mages_fuse(4)
3:30.028 build_a_shard J shadow_bolt Fluffy_Pillow 96483.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(16), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), overwhelming_power(20), archive_of_the_titans(20), ignition_mages_fuse(4)
3:31.349 default H demonbolt Fluffy_Pillow 95804.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core, supreme_commander, wild_imps(18), dreadstalkers(2), vilefiend, portal_summons(7), quick_navigation(4), overwhelming_power(19), archive_of_the_titans(20), ignition_mages_fuse(4)
3:32.345 default E call_dreadstalkers Fluffy_Pillow 94800.0/100000: 95% mana | 4.0/5: 80% soul_shard supreme_commander, wild_imps(18), dreadstalkers(2), vilefiend, portal_summons(7), quick_navigation(4), overwhelming_power(18), archive_of_the_titans(20), ignition_mages_fuse(5)
3:33.891 build_a_shard J shadow_bolt Fluffy_Pillow 96346.0/100000: 96% mana | 2.0/5: 40% soul_shard supreme_commander, wild_imps(13), dreadstalkers(4), vilefiend, portal_summons(7), quick_navigation(4), overwhelming_power(17), archive_of_the_titans(20), ignition_mages_fuse(5)
3:35.196 default G hand_of_guldan Fluffy_Pillow 95651.0/100000: 96% mana | 3.0/5: 60% soul_shard supreme_commander, wild_imps(12), dreadstalkers(4), vilefiend, quick_navigation_final, overwhelming_power(15), archive_of_the_titans(20), ignition_mages_fuse(5)
3:36.149 build_a_shard J shadow_bolt Fluffy_Pillow 96604.0/100000: 97% mana | 0.0/5: 0% soul_shard supreme_commander, wild_imps(13), dreadstalkers(4), vilefiend, quick_navigation_final, overwhelming_power(14), archive_of_the_titans(20)
3:37.614 build_a_shard J shadow_bolt Fluffy_Pillow 96069.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_calling, supreme_commander, wild_imps(2), dreadstalkers(4), vilefiend, quick_navigation_final, overwhelming_power(13), archive_of_the_titans(20)
3:39.086 build_a_shard J shadow_bolt Fluffy_Pillow 95541.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_calling, supreme_commander, wild_imps(4), dreadstalkers(4), vilefiend, quick_navigation_final, overwhelming_power(11), archive_of_the_titans(20)
3:40.574 default G hand_of_guldan Fluffy_Pillow 95029.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(10), archive_of_the_titans(20)
3:41.696 default H demonbolt Fluffy_Pillow 96151.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(9), archive_of_the_titans(20)
3:42.822 default H demonbolt Fluffy_Pillow 95277.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(5), dreadstalkers(2), quick_navigation_final, overwhelming_power(8), archive_of_the_titans(20)
3:43.959 default G hand_of_guldan Fluffy_Pillow 94414.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(7), archive_of_the_titans(20)
3:45.101 build_a_shard J shadow_bolt Fluffy_Pillow 95556.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_calling, supreme_commander, wild_imps(5), dreadstalkers(2), quick_navigation_final, overwhelming_power(5), archive_of_the_titans(20)
3:46.638 default H demonbolt Fluffy_Pillow 95093.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(5), overwhelming_power(4), archive_of_the_titans(20)
3:47.884 default G hand_of_guldan Fluffy_Pillow 94339.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(6), overwhelming_power(3), archive_of_the_titans(20)
3:49.138 default H demonbolt Fluffy_Pillow 95593.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(7), quick_navigation, overwhelming_power(25), archive_of_the_titans(20)
3:50.236 build_a_shard J shadow_bolt Fluffy_Pillow 94691.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), quick_navigation, overwhelming_power(24), archive_of_the_titans(20)
3:51.709 build_a_shard J shadow_bolt Fluffy_Pillow 94164.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), quick_navigation, overwhelming_power(23), archive_of_the_titans(20)
3:53.188 default G hand_of_guldan Fluffy_Pillow 93643.0/100000: 94% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(7), quick_navigation, overwhelming_power(21), archive_of_the_titans(20)
3:54.312 default E call_dreadstalkers Fluffy_Pillow 94767.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), quick_navigation, overwhelming_power(20), archive_of_the_titans(20)
3:55.440 build_a_shard J shadow_bolt Fluffy_Pillow 95895.0/100000: 96% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation, overwhelming_power(19), archive_of_the_titans(20)
3:56.955 build_a_shard J shadow_bolt Fluffy_Pillow 95410.0/100000: 95% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(2), overwhelming_power(18), archive_of_the_titans(20)
3:58.468 default D summon_vilefiend Fluffy_Pillow 94923.0/100000: 95% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(2), overwhelming_power(16), archive_of_the_titans(20)
3:59.999 build_a_shard J shadow_bolt Fluffy_Pillow 96454.0/100000: 96% mana | 2.0/5: 40% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(15), archive_of_the_titans(20)
4:01.538 default G hand_of_guldan Fluffy_Pillow 95993.0/100000: 96% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(13), archive_of_the_titans(20)
4:02.708 build_a_shard J shadow_bolt Fluffy_Pillow 97163.0/100000: 97% mana | 0.0/5: 0% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(12), archive_of_the_titans(20)
4:04.272 build_a_shard J shadow_bolt Fluffy_Pillow 96727.0/100000: 97% mana | 1.0/5: 20% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(10), archive_of_the_titans(20)
4:05.854 build_a_shard J shadow_bolt Fluffy_Pillow 96309.0/100000: 96% mana | 2.0/5: 40% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(9), archive_of_the_titans(20)
4:07.446 default G hand_of_guldan Fluffy_Pillow 95901.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(4), vilefiend, quick_navigation(2), overwhelming_power(7), archive_of_the_titans(20)
4:08.655 default H demonbolt Fluffy_Pillow 97110.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(3), vilefiend, quick_navigation(2), overwhelming_power(6), archive_of_the_titans(20)
4:09.869 default H demonbolt Fluffy_Pillow 96324.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(4), vilefiend, quick_navigation(2), overwhelming_power(5), archive_of_the_titans(20)
4:11.091 build_a_shard J shadow_bolt Fluffy_Pillow 95546.0/100000: 96% mana | 4.0/5: 80% soul_shard wild_imps(6), vilefiend, quick_navigation(3), overwhelming_power(3), archive_of_the_titans(20)
4:12.732 default G hand_of_guldan Fluffy_Pillow 95187.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_core, wild_imps(4), vilefiend, quick_navigation(3), overwhelming_power(2), archive_of_the_titans(20)
4:13.969 default H demonbolt Fluffy_Pillow 96424.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(4), vilefiend, quick_navigation(3), overwhelming_power, archive_of_the_titans(20)
4:15.216 default E call_dreadstalkers Fluffy_Pillow 95671.0/100000: 96% mana | 4.0/5: 80% soul_shard wild_imps(5), quick_navigation(3), archive_of_the_titans(20)
4:16.885 build_a_shard J shadow_bolt Fluffy_Pillow 97340.0/100000: 97% mana | 2.0/5: 40% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
4:18.556 default G hand_of_guldan Fluffy_Pillow 97011.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
4:19.809 build_a_shard J shadow_bolt Fluffy_Pillow 98264.0/100000: 98% mana | 0.0/5: 0% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
4:21.480 build_a_shard J shadow_bolt Fluffy_Pillow 97935.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
4:23.148 build_a_shard J shadow_bolt Fluffy_Pillow 97603.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
4:24.818 default G hand_of_guldan Fluffy_Pillow 97273.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
4:26.069 build_a_shard J shadow_bolt Fluffy_Pillow 98524.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
4:27.739 build_a_shard J shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
4:29.399 build_a_shard J shadow_bolt Fluffy_Pillow 97665.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(6), quick_navigation(4), archive_of_the_titans(20)
4:31.055 default G hand_of_guldan Fluffy_Pillow 97321.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(4), quick_navigation_final, archive_of_the_titans(20)
4:32.243 build_a_shard J shadow_bolt Fluffy_Pillow 98509.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(4), quick_navigation_final, archive_of_the_titans(20)
4:33.826 build_a_shard J shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(5), quick_navigation_final, archive_of_the_titans(20)
4:35.408 default H demonbolt Fluffy_Pillow 97587.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(5), quick_navigation_final, archive_of_the_titans(20)
4:36.595 build_a_shard J shadow_bolt Fluffy_Pillow 96774.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core, wild_imps(4), quick_navigation_final, archive_of_the_titans(20)
4:38.177 default E call_dreadstalkers Fluffy_Pillow 96356.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(4), quick_navigation_final, archive_of_the_titans(20)
4:39.365 default G hand_of_guldan Fluffy_Pillow 97544.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:40.554 default H demonbolt Fluffy_Pillow 98733.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:41.742 default G hand_of_guldan Fluffy_Pillow 97921.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), archive_of_the_titans(20)
4:43.020 build_a_shard J shadow_bolt Fluffy_Pillow 99199.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), archive_of_the_titans(20)
4:44.720 build_a_shard J shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), archive_of_the_titans(20)
4:46.421 default D summon_vilefiend Fluffy_Pillow 97705.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), archive_of_the_titans(20)
4:48.121 default F summon_demonic_tyrant Fluffy_Pillow 99405.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, archive_of_the_titans(20)
4:49.821 build_a_shard J shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, archive_of_the_titans(20)
4:51.523 build_a_shard J shadow_bolt Fluffy_Pillow 97706.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation, archive_of_the_titans(20)
4:53.212 default G hand_of_guldan Fluffy_Pillow 97395.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation, archive_of_the_titans(20)
4:54.481 build_a_shard J shadow_bolt Fluffy_Pillow 98664.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation, archive_of_the_titans(20)
4:56.172 build_a_shard J shadow_bolt Fluffy_Pillow 98006.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation, archive_of_the_titans(20)
4:57.862 build_a_shard J shadow_bolt Fluffy_Pillow 97696.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation, archive_of_the_titans(20)
4:59.552 default E call_dreadstalkers Fluffy_Pillow 97386.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation, archive_of_the_titans(20)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 9026 8206 7205
Intellect 1467 -3 8475 7287 5476 (377)
Spirit 0 0 0 0 0
Health 180520 164120 0
Mana 100000 100000 0
Soul Shard 5 5 0
Spell Power 8475 7287 0
Crit 17.68% 17.68% 913
Haste 17.90% 17.90% 1217
Damage / Heal Versatility 1.52% 1.52% 129
ManaReg per Second 1000 1000 0
Mastery 26.55% 26.55% 742
Armor 1159 1159 1159
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Horrific Amalgam's Hood
ilevel: 390, stats: { 154 Armor, +655 Int, +1189 Sta }
azerite powers: { Supreme Commander, Overwhelming Power, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Amice of Corrupting Horror
ilevel: 390, stats: { 142 Armor, +491 Int, +892 Sta }
azerite powers: { Archive of the Titans, Heed My Call, Azerite Empowered }
Local Chest Robes of the Unraveler
ilevel: 390, stats: { 189 Armor, +655 Int, +1189 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Azerite Empowered }
Local Waist Cord of Septic Envelopment
ilevel: 385, stats: { 103 Armor, +247 Int, +417 Sta, +115 Haste, +68 Crit }
Local Legs Leggings of Lingering Infestation
ilevel: 385, stats: { 160 Armor, +329 Int, +556 Sta, +133 Haste, +112 Mastery }
Local Feet Volatile Walkers
ilevel: 385, stats: { 126 Armor, +247 Int, +417 Sta, +111 Crit, +72 Vers }
Local Wrists Void-Lashed Wristband
ilevel: 385, stats: { 80 Armor, +185 Int, +312 Sta, +81 Mastery, +57 Vers }
Local Hands Mutagenic Protofluid Handwraps
ilevel: 385, stats: { 114 Armor, +247 Int, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 370, stats: { +271 Int }
Local Trinket2 Vigilant's Bloodshaper
ilevel: 385, stats: { +313 Int }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Tusk of the Reborn Prophet
ilevel: 385, weapon: { 126 - 211, 1.8 }, stats: { +164 Int, +277 Sta, +70 Crit, +51 Haste, +792 Int }, enchant: quick_navigation
Local Off Hand Codex of Imminent Ruin
ilevel: 385, stats: { +277 Sta, +66 Haste, +56 Mastery, +503 Int }

Talents

Level
15 Dreadlash (Demonology Warlock) Demonic Strength (Demonology Warlock) Bilescourge Bombers (Demonology Warlock)
30 Demonic Calling (Demonology Warlock) Power Siphon (Demonology Warlock) Doom (Demonology Warlock)
45 Demon Skin Burning Rush Dark Pact
60 From the Shadows (Demonology Warlock) Soul Strike (Demonology Warlock) Summon Vilefiend (Demonology Warlock)
75 Darkfury Mortal Coil Demonic Circle
90 Soul Conduit (Demonology Warlock) Inner Demons (Demonology Warlock) Grimoire: Felguard (Demonology Warlock)
100 Sacrificed Souls (Demonology Warlock) Demonic Consumption (Demonology Warlock) Nether Portal (Demonology Warlock)

Profile

warlock="DL_ID_Felguard"
source=default
spec=demonology
level=120
race=troll
role=spell
position=ranged_back
talents=1103023

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/inner_demons,if=talent.inner_demons.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/demonbolt

# Executed every time the actor is available.
actions=potion,if=pet.demonic_tyrant.active|target.time_to_die<30
actions+=/use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
actions+=/demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
actions+=/call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
actions+=/call_action_list,name=implosion,if=spell_targets.implosion>1
actions+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions+=/summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions+=/call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions+=/summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
actions+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
actions+=/doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
actions+=/hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
actions+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
actions+=/bilescourge_bombers
actions+=/call_action_list,name=build_a_shard

actions.build_a_shard=demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
actions.build_a_shard+=/soul_strike
actions.build_a_shard+=/shadow_bolt

actions.implosion=implosion,if=(buff.wild_imps.stack>=6&(soul_shard<3|prev_gcd.1.call_dreadstalkers|buff.wild_imps.stack>=9|prev_gcd.1.bilescourge_bombers|(!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan))&!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan&buff.demonic_power.down)|(time_to_die<3&buff.wild_imps.stack>0)|(prev_gcd.2.call_dreadstalkers&buff.wild_imps.stack>2&!talent.demonic_calling.enabled)
actions.implosion+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.implosion+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.implosion+=/summon_demonic_tyrant
actions.implosion+=/hand_of_guldan,if=soul_shard>=5
actions.implosion+=/hand_of_guldan,if=soul_shard>=3&(((prev_gcd.2.hand_of_guldan|buff.wild_imps.stack>=3)&buff.wild_imps.stack<9)|cooldown.summon_demonic_tyrant.remains<=gcd*2|buff.demonic_power.remains>gcd*2)
actions.implosion+=/demonbolt,if=prev_gcd.1.hand_of_guldan&soul_shard>=1&(buff.wild_imps.stack<=3|prev_gcd.3.hand_of_guldan)&soul_shard<4&buff.demonic_core.up
actions.implosion+=/summon_vilefiend,if=(cooldown.summon_demonic_tyrant.remains>40&spell_targets.implosion<=2)|cooldown.summon_demonic_tyrant.remains<12
actions.implosion+=/bilescourge_bombers,if=cooldown.summon_demonic_tyrant.remains>9
actions.implosion+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions.implosion+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&(buff.demonic_core.stack>=3|buff.demonic_core.remains<=gcd*5.7)
actions.implosion+=/doom,cycle_targets=1,max_cycle_targets=7,if=refreshable
actions.implosion+=/call_action_list,name=build_a_shard

actions.nether_portal=call_action_list,name=nether_portal_building,if=cooldown.nether_portal.remains<20
actions.nether_portal+=/call_action_list,name=nether_portal_active,if=cooldown.nether_portal.remains>160

actions.nether_portal_active=grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.nether_portal_active+=/summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions.nether_portal_active+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.nether_portal_active+=/call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
actions.nether_portal_active+=/hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
actions.nether_portal_active+=/demonbolt,if=buff.demonic_core.up
actions.nether_portal_active+=/call_action_list,name=build_a_shard

actions.nether_portal_building=nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
actions.nether_portal_building+=/call_dreadstalkers
actions.nether_portal_building+=/hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
actions.nether_portal_building+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
actions.nether_portal_building+=/hand_of_guldan,if=soul_shard>=5
actions.nether_portal_building+=/call_action_list,name=build_a_shard

head=horrific_amalgams_hood,id=160616,bonus_id=4824/1507/4775,azerite_powers=458/30/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536,azerite_level=33
shoulders=amice_of_corrupting_horror,id=160726,bonus_id=4824/1507/4775,azerite_powers=483/22/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=robes_of_the_unraveler,id=160614,bonus_id=4824/1507/4775,azerite_powers=483/30/13
wrists=voidlashed_wristband,id=160617,bonus_id=4800/1507
hands=mutagenic_protofluid_handwraps,id=160715,bonus_id=4800/1507
waist=cord_of_septic_envelopment,id=160727,bonus_id=4800/1507
legs=leggings_of_lingering_infestation,id=160615,bonus_id=4800/1507
feet=volatile_walkers,id=160714,bonus_id=4800/1507
finger1=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=ignition_mages_fuse,id=159615,bonus_id=1542/4779
trinket2=vigilants_bloodshaper,id=160651,bonus_id=4800/1507
main_hand=tusk_of_the_reborn_prophet,id=160691,bonus_id=4800/1507,enchant=quick_navigation
off_hand=codex_of_imminent_ruin,id=160696,bonus_id=4800/1507

# Gear Summary
# gear_ilvl=385.25
# gear_stamina=7205
# gear_intellect=5476
# gear_crit_rating=913
# gear_haste_rating=1217
# gear_mastery_rating=742
# gear_versatility_rating=129
# gear_armor=1159
default_pet=felguard

DL_ID_Imp : 17201 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17200.5 17200.5 15.3 / 0.089% 2188.2 / 12.7% 4.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
970.6 961.1 Mana 0.00% 47.4 100.0% 100%
Talents
  • 15: Dreadlash (Demonology Warlock)
  • 30: Demonic Calling (Demonology Warlock)
  • 60: Summon Vilefiend (Demonology Warlock)
  • 90: Inner Demons (Demonology Warlock)
  • 100: Nether Portal (Demonology Warlock)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
DL_ID_Imp 17201
Demonbolt 1336 7.8% 47.0 5.80sec 8526 7500 Direct 47.8 7115 14230 8378 17.8%  

Stats details: demonbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.99 47.82 0.00 0.00 1.1368 0.0000 400634.36 400634.36 0.00 7499.71 7499.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.33 82.25% 7114.77 6520 8308 7116.16 6924 7318 279834 279834 0.00
crit 8.49 17.75% 14230.13 13040 16616 14229.82 0 16616 120800 120800 0.00
 
 

Action details: demonbolt

Static Values
  • id:264178
  • school:shadowflame
  • resource:mana
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:264178
  • name:Demonbolt
  • school:shadowflame
  • tooltip:
  • description:Send the fiery soul of a fallen demon at the enemy, causing {$s1=0} Shadowflame damage.$?c2[ |cFFFFFFFFGenerates 2 Soul Shards.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.667000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Hand of Gul'dan 1099 6.4% 62.9 4.72sec 5245 4751 Direct 62.7 4463 8925 5255 17.8%  

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.86 62.73 0.00 0.00 1.1040 0.0000 329686.29 329686.29 0.00 4750.93 4750.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.60 82.24% 4463.03 1634 5979 4457.33 4084 4797 230272 230272 0.00
crit 11.14 17.76% 8925.09 3267 11958 8907.61 3448 11239 99414 99414 0.00
 
 

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadowflame
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.7000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:2.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadowflame
  • tooltip:
  • description:Calls down a demonic meteor full of Wild Imps which burst forth to attack the target. Deals up to ${$m1*$86040m1} Shadowflame damage on impact to all enemies within $86040A1 yds of the target{$?s196283=false}[, applies Doom to each target,][] and summons up to ${$m1*{$104317m2=0}} Wild Imps, based on Soul Shards consumed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.160000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Heed My Call 140 (201) 0.8% (1.2%) 7.3 37.16sec 8279 0 Direct 7.3 4925 9849 5795 17.7%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.27 7.27 0.00 0.00 0.0000 0.0000 42139.55 42139.55 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.99 82.33% 4924.62 4925 4925 4923.64 0 4925 29485 29485 0.00
crit 1.28 17.67% 9849.24 9849 9849 7224.88 0 9849 12655 12655 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4620.00
  • base_dd_max:4620.00
 
    Heed My Call (_aoe) 60 0.4% 7.3 37.16sec 2485 0 Direct 7.3 2111 4221 2485 17.7%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.27 7.27 0.00 0.00 0.0000 0.0000 18067.83 18067.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.98 82.28% 2110.55 2111 2111 2109.71 0 2111 12628 12628 0.00
crit 1.29 17.72% 4221.10 4221 4221 3098.91 0 4221 5440 5440 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1980.00
  • base_dd_max:1980.00
 
Shadow Bolt 1316 7.7% 94.0 3.13sec 4197 2812 Direct 93.4 3593 7187 4226 17.6%  

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.01 93.35 0.00 0.00 1.4922 0.0000 394522.41 394522.41 0.00 2812.33 2812.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.91 82.38% 3592.87 3335 4297 3593.44 3550 3648 276312 276312 0.00
crit 16.45 17.62% 7187.31 6670 8595 7188.32 6923 7625 118211 118211 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=0} Shadow damage.$?c2[ |cFFFFFFFFGenerates 1 Soul Shard.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.345000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Volatile Blood Explosion 289 1.7% 7.3 36.84sec 11886 0 Direct 7.2 10240 20481 12042 17.6%  

Stats details: volatile_blood_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.30 7.20 0.00 0.00 0.0000 0.0000 86731.35 86731.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.93 82.40% 10240.44 10240 10240 10238.39 0 10240 60769 60769 0.00
crit 1.27 17.60% 20480.88 20481 20481 14933.55 0 20481 25963 25963 0.00
 
 

Action details: volatile_blood_explosion

Static Values
  • id:278057
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278057
  • name:Volatile Blood Explosion
  • school:shadow
  • tooltip:
  • description:Your damaging spells have a chance to launch an orb of charged blood at your target, dealing {$s1=4788} Shadow damage split among all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9607.38
  • base_dd_max:9607.38
 
pet - imp 3137 / 3137
Firebolt 3137 18.3% 103.8 2.89sec 9056 6923 Direct 103.0 7759 15519 9127 17.6%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.79 102.98 0.00 0.00 1.3080 0.0000 939897.06 939897.06 0.00 6923.23 6923.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.82 82.37% 7758.89 7027 9401 7759.85 7622 7908 658089 658089 0.00
crit 18.16 17.63% 15518.89 14053 18802 15520.19 14573 16742 281808 281808 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.568000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - illidari_satyr 1234 / 188
melee 404 0.4% 47.0 2.77sec 388 324 Direct 47.0 330 660 388 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.97 46.97 0.00 0.00 1.1961 0.0000 18220.02 26047.70 30.05 324.29 324.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.69 82.37% 329.72 281 376 329.30 0 368 12757 18238 30.04
crit 8.28 17.63% 659.64 562 753 651.85 0 753 5463 7809 29.72
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 202 0.2% 47.0 2.77sec 194 153 Direct 47.0 165 330 194 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.97 46.97 0.00 0.00 1.2657 0.0000 9117.31 13034.29 30.05 153.35 153.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.64 82.27% 164.87 141 188 164.65 0 184 6371 9109 30.04
crit 8.33 17.73% 329.70 281 376 324.79 0 376 2746 3926 29.63
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Shadow Slash 627 0.6% 10.2 13.09sec 2792 2792 Direct 10.2 2376 4750 2792 17.6%  

Stats details: shadow_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.19 10.19 0.00 0.00 1.0000 0.0000 28452.57 28452.57 0.00 2792.48 2792.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.40 82.45% 2375.65 2026 2711 2370.13 0 2711 19959 19959 0.00
crit 1.79 17.55% 4749.54 4053 5422 3721.52 0 5422 8494 8494 0.00
 
 

Action details: shadow_slash

Static Values
  • id:272012
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272012
  • name:Shadow Slash
  • school:shadow
  • tooltip:
  • description:The Satyr strikes at out with its weapons, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - void_terror 1795 / 270
Double Breath 0 (147) 0.0% (0.8%) 0.0 0.00sec 0 7323

Stats details: double_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 7322.97 7322.97
 
 

Action details: double_breath

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (1) 488 0.4% 7.8 17.47sec 2788 0 Direct 7.8 2368 4728 2788 17.8%  

Stats details: double_breath1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.85 7.85 0.00 0.00 0.0000 0.0000 21877.38 21877.38 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.45 82.21% 2368.03 2026 2711 2355.74 0 2711 15277 15277 0.00
crit 1.40 17.79% 4728.48 4053 5422 3376.56 0 5422 6600 6600 0.00
 
 

Action details: double_breath1

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (2) 489 0.4% 7.8 17.47sec 2789 0 Direct 7.8 2367 4737 2789 17.8%  

Stats details: double_breath2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.85 7.85 0.00 0.00 0.0000 0.0000 21884.68 21884.68 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.45 82.21% 2367.06 2026 2711 2360.17 0 2668 15270 15270 0.00
crit 1.40 17.79% 4737.44 4053 5422 3411.67 0 5422 6615 6615 0.00
 
 

Action details: double_breath2

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
melee 818 0.7% 47.0 2.74sec 776 649 Direct 47.0 660 1319 776 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.04 47.04 0.00 0.00 1.1946 0.0000 36487.15 52162.77 30.05 649.38 649.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.77 82.43% 659.79 562 753 659.01 569 739 25580 36570 30.05
crit 8.27 17.57% 1319.50 1125 1505 1299.07 0 1505 10907 15592 29.62
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - vilefiend 3121 / 1559
Bile Spit 1095 3.2% 6.8 47.18sec 23922 0 Direct 6.8 8822 17650 10358 17.4%  
Periodic 33.4 2778 0 2778 0.0% 22.3%

Stats details: bile_spit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.84 6.83 33.45 33.45 0.0000 2.0000 163657.34 163657.34 0.00 2446.37 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.64 82.60% 8822.42 8474 10104 8822.41 8474 9547 49770 49770 0.00
crit 1.19 17.40% 17650.35 16947 20207 12752.98 0 20207 20976 20976 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.4 100.00% 2777.68 2502 3310 2778.02 2622 2868 92911 92911 0.00
 
 

Action details: bile_spit

Static Values
  • id:267997
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:65.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267997
  • name:Bile Spit
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:The Vilefiend spits a ball of bile at its target, dealing ${$m1*$<demoMastery>} Nature damage and an additional ${$m2*$<demoMastery>} Nature damage every $t2 sec for {$d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.680000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.200000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Headbutt 733 2.1% 30.1 9.83sec 3650 3650 Direct 30.1 3100 6201 3650 17.7%  

Stats details: headbutt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.11 30.11 0.00 0.00 1.0000 0.0000 109907.30 157125.69 30.05 3650.19 3650.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.77 82.26% 3099.95 2737 3621 3100.72 2933 3249 76784 109772 30.05
crit 5.34 17.74% 6201.29 5474 7243 6174.25 0 7243 33123 47353 29.91
 
 

Action details: headbutt

Static Values
  • id:267999
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267999
  • name:Headbutt
  • school:physical
  • tooltip:
  • description:The Vilefiend rams its bladed head into the target, dealing {$s1=0} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1293 3.8% 107.9 2.71sec 1795 1338 Direct 107.9 1526 3051 1795 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.86 107.86 0.00 0.00 1.3409 0.0000 193588.99 276758.71 30.05 1338.45 1338.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.85 82.37% 1525.80 1337 1775 1526.16 1456 1567 135563 193804 30.05
crit 19.02 17.63% 3051.47 2673 3550 3052.30 2792 3295 58026 82955 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - darkhound 1290 / 196
Fel Bite 466 0.4% 10.1 13.22sec 2092 2092 Direct 10.1 1780 3562 2092 17.5%  

Stats details: fel_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.06 10.06 0.00 0.00 1.0000 0.0000 21037.50 30075.64 30.05 2092.04 2092.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.30 82.49% 1779.78 1519 2032 1776.47 0 2032 14764 21107 29.98
crit 1.76 17.51% 3562.30 3037 4064 2787.77 0 4064 6273 8968 23.52
 
 

Action details: fel_bite

Static Values
  • id:272435
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272435
  • name:Fel Bite
  • school:physical
  • tooltip:
  • description:The Darkhound bites its target, causing serious Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 824 0.7% 47.6 2.72sec 776 651 Direct 47.6 660 1321 776 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.59 47.59 0.00 0.00 1.1919 0.0000 36937.94 52807.22 30.05 651.26 651.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.20 82.38% 659.77 562 753 659.08 565 753 25863 36975 30.05
crit 8.39 17.62% 1320.53 1125 1505 1306.21 0 1505 11075 15833 29.76
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - dreadstalker 3640 / 2400
Dreadbite 1335 5.1% 29.0 21.04sec 9087 0 Direct 29.0 7720 15438 9087 17.7%  

Stats details: dreadbite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.04 29.04 0.00 0.00 0.0000 0.0000 263890.47 263890.47 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.89 82.28% 7719.93 7139 9517 7720.06 7445 8007 184463 184463 0.00
crit 5.15 17.72% 15437.85 14278 19033 15366.49 0 19033 79428 79428 0.00
 
 

Action details: dreadbite

Static Values
  • id:205196
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205196
  • name:Dreadbite
  • school:shadow
  • tooltip:
  • description:Bite the target, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 2305 8.9% 311.7 1.90sec 1462 1106 Direct 311.7 1243 2485 1462 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 311.67 311.67 0.00 0.00 1.3222 0.0000 455787.41 651602.83 30.05 1106.04 1106.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 256.53 82.31% 1242.58 1105 1473 1242.75 1227 1264 318763 455710 30.05
crit 55.13 17.69% 2485.31 2211 2947 2485.53 2370 2626 137024 195893 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.83
 
pet - wrathguard 1683 / 257
melee 815 0.7% 47.5 2.73sec 776 650 Direct 47.5 659 1319 776 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.49 47.49 0.00 0.00 1.1944 0.0000 36873.34 52714.87 30.05 649.99 649.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.07 82.26% 659.38 562 753 658.43 565 753 25760 36827 30.05
crit 8.43 17.74% 1318.84 1125 1505 1301.52 0 1505 11113 15888 29.70
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 407 0.4% 47.5 2.73sec 388 307 Direct 47.5 330 659 388 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.49 47.49 0.00 0.00 1.2640 0.0000 18429.97 26347.86 30.05 307.00 307.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.08 82.28% 329.75 281 376 329.25 282 376 12887 18423 30.05
crit 8.41 17.72% 658.83 562 753 648.54 0 753 5543 7925 29.60
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Overhead Assault 462 0.4% 10.0 13.27sec 2092 2092 Direct 10.0 1779 3550 2092 17.6%  

Stats details: overhead_assault

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.05 10.05 0.00 0.00 1.0000 0.0000 21018.68 30048.73 30.05 2091.83 2091.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.28 82.36% 1779.41 1519 2032 1775.48 0 2032 14725 21051 30.00
crit 1.77 17.64% 3550.33 3037 4064 2742.68 0 4064 6294 8998 23.22
 
 

Action details: overhead_assault

Static Values
  • id:272432
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272432
  • name:Overhead Assault
  • school:physical
  • tooltip:
  • description:The Wrathguard smashes its target with a heavy overhand swing.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - wild_imp 3113 / 3043
Fel Firebolt 3113 17.7% 1216.9 0.24sec 750 508 Direct 1212.0 640 1279 753 17.7%  

Stats details: fel_firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1216.90 1212.00 0.00 0.00 1.4773 0.0000 912393.10 912393.10 0.00 507.54 507.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 997.72 82.32% 639.69 569 761 639.77 630 653 638227 638227 0.00
crit 214.28 17.68% 1279.47 1138 1523 1279.62 1250 1325 274166 274166 0.00
 
 

Action details: fel_firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Fel Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.046000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - demonic_tyrant 4674 / 822
Demonfire 4674 4.8% 37.6 6.86sec 6538 4903 Direct 37.6 5561 11126 6551 17.8%  

Stats details: demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.65 37.58 0.00 0.00 1.3336 0.0000 246164.97 246164.97 0.00 4903.00 4903.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.89 82.21% 5561.14 5029 5917 5564.44 5441 5680 171790 171790 0.00
crit 6.68 17.79% 11126.27 10059 11834 11123.10 0 11834 74375 74375 0.00
 
 

Action details: demonfire

Static Values
  • id:270481
  • school:shadowflame
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:270481
  • name:Demonfire
  • school:shadowflame
  • tooltip:
  • description:Deal {$s1=0} Shadowflame damage to your enemy target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.357500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - urzul 1322 / 203
Many Faced Bite 496 0.4% 10.8 12.40sec 2086 2086 Direct 10.8 1777 3551 2086 17.4%  

Stats details: many_faced_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.81 10.81 0.00 0.00 1.0000 0.0000 22547.30 32234.07 30.05 2085.97 2085.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.93 82.58% 1776.80 1519 2032 1772.43 0 1993 15860 22673 30.00
crit 1.88 17.42% 3551.26 3037 4064 2799.18 0 4064 6688 9561 23.70
 
 

Action details: many_faced_bite

Static Values
  • id:272439
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272439
  • name:Many Faced Bite
  • school:physical
  • tooltip:
  • description:The Ur'zul rears up and bites its target, dealing Physical damage. You're not sure which face actually bit you after thinking about it.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 826 0.7% 48.1 2.72sec 777 651 Direct 48.1 659 1319 777 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.11 48.11 0.00 0.00 1.1936 0.0000 37381.66 53441.58 30.05 650.99 650.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.53 82.16% 659.41 562 753 658.38 569 737 26066 37264 30.05
crit 8.58 17.84% 1318.65 1125 1505 1299.58 0 1505 11316 16178 29.66
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - bilescourge 3797 / 572
Toxic Bile 3797 3.3% 60.6 2.14sec 2804 2971 Direct 60.5 2384 4766 2805 17.7%  

Stats details: toxic_bile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.57 60.54 0.00 0.00 0.9436 0.0000 169808.26 169808.26 0.00 2971.27 2971.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.84 82.32% 2383.57 2026 2711 2379.86 0 2668 118793 118793 0.00
crit 10.70 17.68% 4766.48 4053 5422 4728.07 0 5422 51016 51016 0.00
 
 

Action details: toxic_bile

Static Values
  • id:272167
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272167
  • name:Toxic Bile
  • school:nature
  • tooltip:
  • description:The Bilescourge spits wads of Toxic Bile at its target, dealing Nature damage.
 
pet - shivarra 1888 / 287
melee 812 0.7% 47.0 2.80sec 776 650 Direct 47.0 659 1318 776 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.02 47.02 0.00 0.00 1.1952 0.0000 36499.82 52180.88 30.05 649.51 649.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.68 82.26% 659.49 562 753 658.62 569 739 25508 36467 30.05
crit 8.34 17.74% 1318.01 1125 1505 1298.49 0 1505 10992 15714 29.64
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 406 0.4% 47.0 2.80sec 388 307 Direct 47.0 330 659 388 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.02 47.02 0.00 0.00 1.2649 0.0000 18238.26 26073.78 30.05 306.65 306.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.72 82.34% 329.72 281 376 329.28 283 367 12766 18250 30.05
crit 8.30 17.66% 659.21 562 753 648.07 0 753 5473 7824 29.58
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Multi-Slash 0 (102) 0.0% (0.6%) 0.0 0.00sec 0 3932

Stats details: multislash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 3932.21 3932.21
 
 

Action details: multislash

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (1) 168 0.1% 7.7 18.31sec 984 0 Direct 7.7 835 1673 984 17.8%  

Stats details: multislash1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.69 7.69 0.00 0.00 0.0000 0.0000 7564.88 10814.91 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.32 82.22% 835.10 717 959 831.89 0 959 5278 7546 29.94
crit 1.37 17.78% 1672.57 1434 1919 1182.38 0 1919 2287 3269 21.23
 
 

Action details: multislash1

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (2) 167 0.1% 7.7 18.31sec 982 0 Direct 7.7 836 1668 982 17.6%  

Stats details: multislash2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.69 7.69 0.00 0.00 0.0000 0.0000 7550.76 10794.72 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.33 82.39% 835.57 717 959 831.33 0 944 5292 7566 29.90
crit 1.35 17.61% 1668.17 1434 1919 1175.91 0 1919 2258 3229 21.20
 
 

Action details: multislash2

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (3) 167 0.1% 7.7 18.31sec 982 0 Direct 7.7 835 1670 982 17.5%  

Stats details: multislash3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.69 7.69 0.00 0.00 0.0000 0.0000 7545.60 10787.34 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.34 82.49% 835.42 717 959 830.95 0 944 5298 7573 29.89
crit 1.35 17.51% 1669.56 1434 1919 1169.17 0 1919 2248 3214 21.04
 
 

Action details: multislash3

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (4) 168 0.1% 7.7 18.31sec 984 0 Direct 7.7 835 1672 984 17.8%  

Stats details: multislash4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.69 7.69 0.00 0.00 0.0000 0.0000 7565.62 10815.96 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.32 82.20% 835.12 717 959 831.58 0 944 5278 7545 29.93
crit 1.37 17.80% 1672.35 1434 1919 1185.96 0 1919 2288 3271 21.31
 
 

Action details: multislash4

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - vicious_hellhound 1043 / 159
Demon Fangs 647 0.6% 10.5 12.85sec 2803 2804 Direct 10.5 2374 4745 2803 18.1%  

Stats details: demon_fangs

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.45 10.45 0.00 0.00 1.0000 0.0000 29302.99 29302.99 0.00 2803.58 2803.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.56 81.90% 2374.15 2026 2711 2368.68 0 2659 20323 20323 0.00
crit 1.89 18.10% 4745.39 4053 5422 3777.99 0 5422 8980 8980 0.00
 
 

Action details: demon_fangs

Static Values
  • id:272013
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272013
  • name:Demon Fangs
  • school:shadowflame
  • tooltip:
  • description:The Vicious Hellhound chomps at its target, dealing Shadowflame damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 396 0.3% 91.5 1.43sec 195 319 Direct 91.5 165 331 195 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.48 91.48 0.00 0.00 0.6101 0.0000 17795.82 25441.26 30.05 318.87 318.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.31 82.33% 165.29 141 188 164.98 0 184 12448 17796 30.04
crit 16.17 17.67% 330.77 281 376 328.93 0 367 5348 7646 29.94
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - prince_malchezaar 4535 / 389
melee 3026 1.5% 20.8 1.59sec 3689 3083 Direct 20.8 3127 6263 3689 17.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.78 20.78 0.00 0.00 1.1968 0.0000 76679.42 109622.44 30.05 3082.84 3082.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.06 82.06% 3126.74 2665 3566 3120.07 2699 3523 53327 76237 30.05
crit 3.73 17.94% 6263.17 5330 7131 6003.79 0 7131 23353 33386 28.88
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 1509 0.7% 20.8 1.59sec 1838 1450 Direct 20.8 1563 3131 1838 17.5%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.78 20.78 0.00 0.00 1.2672 0.0000 38198.38 54609.17 30.05 1450.42 1450.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.14 82.49% 1563.47 1333 1783 1560.01 1350 1746 26805 38320 30.05
crit 3.64 17.51% 3130.71 2675 3566 2976.11 0 3566 11394 16289 28.62
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - eye_of_guldan 968 / 82
Eye of Gul'dan 968 0.5% 28.2 5.45sec 862 1130 Periodic 61.0 399 0 399 0.0% 59.8%

Stats details: eye_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.25 0.00 60.97 60.97 0.7633 2.9398 24353.17 24353.17 0.00 121.27 1129.50
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.0 100.00% 399.40 182 484 397.56 0 435 24353 24353 0.00
 
 

Action details: eye_of_guldan

Static Values
  • id:272131
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272131
  • name:Eye of Gul'dan
  • school:shadowflame
  • tooltip:Suffering Shadow damage every $t1 sec.
  • description:The Eye of Gul'dan stares deep into the target's soul, causing Shadow Damage every $t1 sec for {$d=15 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.300000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
DL_ID_Imp
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_ID_Imp
  • harmful:false
  • if_expr:
 
Berserking 2.0 186.80sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:pet.demonic_tyrant.active|target.time_to_die<=15
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Call Dreadstalkers 14.6 21.04sec

Stats details: call_dreadstalkers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.57 0.00 0.00 0.00 1.2043 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: call_dreadstalkers

Static Values
  • id:104316
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:20.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
Spelldata
  • id:104316
  • name:Call Dreadstalkers
  • school:shadow
  • tooltip:
  • description:Summons {$s1=2} ferocious Dreadstalkers to attack the target for {$193332d=12 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_ID_Imp
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_ID_Imp
  • harmful:false
  • if_expr:
 
inner_demons 1.0 0.00sec

Stats details: inner_demons

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: inner_demons

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.inner_demons.enabled
 
Nether Portal 2.0 0.00sec

Stats details: nether_portal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.2378 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: nether_portal

Static Values
  • id:267217
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Spelldata
  • id:267217
  • name:Nether Portal
  • school:shadow
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Summon Demonic Tyrant 3.6 93.47sec

Stats details: summon_demonic_tyrant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.58 0.00 0.00 0.00 1.5081 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_demonic_tyrant

Static Values
  • id:265187
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
Spelldata
  • id:265187
  • name:Summon Demonic Tyrant
  • school:shadow
  • tooltip:
  • description:Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.
 
summon_random_demon 17.8 14.71sec

Stats details: summon_random_demon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.77 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_random_demon

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
 
Summon Vilefiend 6.8 47.18sec

Stats details: summon_vilefiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.84 0.00 0.00 0.00 1.5528 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_vilefiend

Static Values
  • id:264119
  • school:fire
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Spelldata
  • id:264119
  • name:Summon Vilefiend
  • school:fire
  • tooltip:
  • description:Summon a Vilefiend to fight for you for the next {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:28.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=7}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 100.9sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 186.9sec 186.9sec 6.76% 8.54% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Demonic Calling 12.8 15.5 23.3sec 10.2sec 52.14% 83.46% 15.5(15.5) 0.1

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_calling_1:52.14%

Trigger Attempt Success

  • trigger_pct:19.94%

Spelldata details

  • id:205146
  • name:Demonic Calling
  • tooltip:Your next Call Dreadstalkers costs {$205145s1=1} less Soul Shard and has no cast time.
  • description:{$@spelldesc205145=Shadow Bolt{$?s264178=true}[ and Demonbolt have][ has] a {$h=20}% chance to make your next Call Dreadstalkers cost {$s1=1} less Soul Shard and have no cast time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Demonic Core 24.5 32.1 11.7sec 5.0sec 40.33% 100.00% 4.8(4.8) 0.4

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_demonic_core
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_core_1:16.47%
  • demonic_core_2:15.90%
  • demonic_core_3:5.43%
  • demonic_core_4:2.53%

Trigger Attempt Success

  • trigger_pct:23.60%

Spelldata details

  • id:264173
  • name:Demonic Core
  • tooltip:The cast time of Demonbolt is reduced by {$s1=100}%.
  • description:{$@spelldesc267102=When your Wild Imps expend all of their energy or are imploded, you have a {$s1=10}% chance to absorb their life essence, granting you a stack of Demonic Core. When your summoned Dreadstalkers fade away, you have a {$s2=100}% chance to absorb their life essence, granting you a stack of Demonic Core. Demonic Core reduces the cast time of Demonbolt by {$264173s1=100}%. Maximum {$264173u=4} stacks.}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Demonic Power 3.6 0.0 93.5sec 93.5sec 17.61% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_demonic_power
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_power_1:17.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:265273
  • name:Demonic Power
  • tooltip:Damage dealt by your demons increased by {$s2=15}%.
  • description:{$@spelldesc265187=Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
dreadstalkers 11.6 17.6 26.7sec 10.2sec 65.94% 0.00% 0.0(0.0) 10.9

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_dreadstalkers
  • max_stacks:4
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • dreadstalkers_2:59.58%
  • dreadstalkers_4:6.36%

Trigger Attempt Success

  • trigger_pct:100.00%
eyes_of_guldan 0.2 0.5 165.0sec 2.6sec 1.37% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_eyes_of_guldan
  • max_stacks:4
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • eyes_of_guldan_4:1.38%

Trigger Attempt Success

  • trigger_pct:100.00%
Ignition Mage's Fuse 2.4 0.0 171.7sec 171.7sec 14.82% 0.00% 2.0(2.0) 2.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:275.80

Stack Uptimes

  • ignition_mages_fuse_1:3.12%
  • ignition_mages_fuse_2:3.08%
  • ignition_mages_fuse_3:3.04%
  • ignition_mages_fuse_4:2.88%
  • ignition_mages_fuse_5:2.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Nether Portal 2.0 0.0 182.9sec 0.0sec 10.14% 17.98% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_nether_portal
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • nether_portal_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267217
  • name:Nether Portal
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Overwhelming Power 4.3 2.9 67.1sec 36.9sec 43.97% 0.00% 2.9(40.2) 0.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • overwhelming_power_1:1.29%
  • overwhelming_power_2:1.32%
  • overwhelming_power_3:1.36%
  • overwhelming_power_4:1.40%
  • overwhelming_power_5:1.43%
  • overwhelming_power_6:1.47%
  • overwhelming_power_7:1.51%
  • overwhelming_power_8:1.55%
  • overwhelming_power_9:1.59%
  • overwhelming_power_10:1.63%
  • overwhelming_power_11:1.68%
  • overwhelming_power_12:1.72%
  • overwhelming_power_13:1.77%
  • overwhelming_power_14:1.82%
  • overwhelming_power_15:1.87%
  • overwhelming_power_16:1.92%
  • overwhelming_power_17:1.98%
  • overwhelming_power_18:2.03%
  • overwhelming_power_19:2.09%
  • overwhelming_power_20:2.15%
  • overwhelming_power_21:2.21%
  • overwhelming_power_22:2.27%
  • overwhelming_power_23:2.34%
  • overwhelming_power_24:2.39%
  • overwhelming_power_25:1.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
portal_summons 2.0 13.4 182.9sec 14.5sec 19.53% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_portal_summons
  • max_stacks:40
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • portal_summons_1:1.70%
  • portal_summons_2:0.77%
  • portal_summons_3:1.25%
  • portal_summons_4:1.52%
  • portal_summons_5:1.86%
  • portal_summons_6:1.79%
  • portal_summons_7:4.03%
  • portal_summons_8:5.82%
  • portal_summons_9:0.78%

Trigger Attempt Success

  • trigger_pct:100.00%
prince_malchezaar 0.2 0.0 167.4sec 106.7sec 1.39% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_prince_malchezaar
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • prince_malchezaar_1:1.39%

Trigger Attempt Success

  • trigger_pct:100.00%
Quick Navigation 6.0 22.4 52.3sec 10.3sec 67.41% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:17.64%
  • quick_navigation_2:17.02%
  • quick_navigation_3:16.50%
  • quick_navigation_4:16.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.3 0.0 52.3sec 52.3sec 17.45% 0.00% 0.0(0.0) 5.1

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:17.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Supreme Commander 4.3 0.1 82.6sec 79.8sec 17.02% 0.00% 0.1(0.1) 3.3

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_supreme_commander
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:838.00

Stack Uptimes

  • supreme_commander_1:17.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279878
  • name:Supreme Commander
  • tooltip:
  • description:When your Demonic Tyrant expires, consume its life essence, granting you a stack of Demonic Core and increasing your Intellect by {$s1=398} for {$279885d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tyrant 3.6 0.0 93.5sec 93.5sec 17.61% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_tyrant
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • tyrant_1:17.61%

Trigger Attempt Success

  • trigger_pct:100.00%
vilefiend 6.8 0.0 47.2sec 47.2sec 50.00% 0.00% 0.0(0.0) 6.4

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_vilefiend
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vilefiend_1:50.00%

Trigger Attempt Success

  • trigger_pct:100.00%
wild_imps 2.0 188.1 133.4sec 0.0sec 97.77% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_wild_imps
  • max_stacks:40
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • wild_imps_1:1.42%
  • wild_imps_2:2.06%
  • wild_imps_3:10.39%
  • wild_imps_4:20.90%
  • wild_imps_5:8.07%
  • wild_imps_6:14.80%
  • wild_imps_7:18.61%
  • wild_imps_8:5.06%
  • wild_imps_9:3.55%
  • wild_imps_10:3.96%
  • wild_imps_11:4.19%
  • wild_imps_12:1.69%
  • wild_imps_13:1.22%
  • wild_imps_14:1.27%
  • wild_imps_15:0.36%
  • wild_imps_16:0.16%
  • wild_imps_17:0.06%
  • wild_imps_18:0.01%
  • wild_imps_19:0.00%
  • wild_imps_20:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Inner Demons

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_inner_demons
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:12.00

Stack Uptimes

  • inner_demons_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267216
  • name:Inner Demons
  • tooltip:
  • description:You passively summon a Wild Imp to fight for you every $t1 sec, and have a {$s1=10}% chance to also summon an additional Demon to fight for you for {$s2=15} sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
summon_random_demon 17.8 14.0sec
one_shard_hog 9.0 21.9sec
two_shard_hog 4.2 48.6sec
three_shard_hog 49.7 5.7sec
portal_summon 15.4 13.7sec

Resources

Resource Usage Type Count Total Average RPE APR
DL_ID_Imp
call_dreadstalkers Soul Shard 14.6 17.0 1.2 1.2 0.0
demonbolt Mana 48.0 95982.0 2000.0 2042.5 4.2
hand_of_guldan Soul Shard 62.9 166.4 2.6 2.6 1980.9
shadow_bolt Mana 94.0 188024.4 2000.0 2000.0 2.1
summon_demonic_tyrant Mana 3.6 7157.7 2000.0 2000.2 0.0
summon_vilefiend Soul Shard 6.8 6.8 1.0 1.0 0.0
pet - imp
firebolt Energy 103.8 4151.6 40.0 40.0 226.4
pet - wild_imp
fel_firebolt Energy 1216.9 18629.8 15.3 15.3 49.0
Resource Gains Type Count Total Average Overflow
demonbolt Soul Shard 47.99 95.84 (50.48%) 2.00 0.14 0.15%
shadow_bolt Soul Shard 94.01 94.01 (49.52%) 1.00 0.01 0.01%
mana_regen Mana 556.60 288311.92 (100.00%) 517.99 11131.41 3.72%
pet - imp
energy_regen Energy 425.57 3980.96 (100.00%) 9.35 22.74 0.57%
pet - demonic_tyrant
energy_regen Energy 37.65 0.00 (0.00%) 0.00 759.97 100.00%
pet - bilescourge
energy_regen Energy 14.74 0.00 (0.00%) 0.00 203.69 100.00%
pet - bilescourge
energy_regen Energy 12.98 0.00 (0.00%) 0.00 179.00 100.00%
pet - bilescourge
energy_regen Energy 16.18 0.00 (0.00%) 0.00 223.95 100.00%
pet - bilescourge
energy_regen Energy 7.90 0.00 (0.00%) 0.00 109.07 100.00%
pet - bilescourge
energy_regen Energy 8.11 0.00 (0.00%) 0.00 112.41 100.00%
pet - bilescourge
energy_regen Energy 0.01 0.00 (0.00%) 0.00 0.06 100.00%
pet - bilescourge
energy_regen Energy 0.01 0.00 (0.00%) 0.00 0.05 100.00%
Resource RPS-Gain RPS-Loss
Mana 961.08 970.59
Soul Shard 0.63 0.63
Combat End Resource Mean Min Max
Mana 97100.81 91015.00 100000.00
Soul Shard 2.62 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.1%

Statistics & Data Analysis

Fight Length
Sample Data DL_ID_Imp Fight Length
Count 4999
Mean 299.99
Minimum 240.01
Maximum 359.96
Spread ( max - min ) 119.95
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data DL_ID_Imp Damage Per Second
Count 4999
Mean 17200.54
Minimum 15696.14
Maximum 19946.57
Spread ( max - min ) 4250.43
Range [ ( max - min ) / 2 * 100% ] 12.36%
Standard Deviation 552.4559
5th Percentile 16375.02
95th Percentile 18188.24
( 95th Percentile - 5th Percentile ) 1813.22
Mean Distribution
Standard Deviation 7.8137
95.00% Confidence Intervall ( 17185.23 - 17215.86 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3963
0.1 Scale Factor Error with Delta=300 2606
0.05 Scale Factor Error with Delta=300 10422
0.01 Scale Factor Error with Delta=300 260543
Priority Target DPS
Sample Data DL_ID_Imp Priority Target Damage Per Second
Count 4999
Mean 17200.54
Minimum 15696.14
Maximum 19946.57
Spread ( max - min ) 4250.43
Range [ ( max - min ) / 2 * 100% ] 12.36%
Standard Deviation 552.4559
5th Percentile 16375.02
95th Percentile 18188.24
( 95th Percentile - 5th Percentile ) 1813.22
Mean Distribution
Standard Deviation 7.8137
95.00% Confidence Intervall ( 17185.23 - 17215.86 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3963
0.1 Scale Factor Error with Delta=300 2606
0.05 Scale Factor Error with Delta=300 10422
0.01 Scale Factor Error with Delta=300 260543
DPS(e)
Sample Data DL_ID_Imp Damage Per Second (Effective)
Count 4999
Mean 17200.54
Minimum 15696.14
Maximum 19946.57
Spread ( max - min ) 4250.43
Range [ ( max - min ) / 2 * 100% ] 12.36%
Damage
Sample Data DL_ID_Imp Damage
Count 4999
Mean 1271781.78
Minimum 880314.58
Maximum 1740059.47
Spread ( max - min ) 859744.90
Range [ ( max - min ) / 2 * 100% ] 33.80%
DTPS
Sample Data DL_ID_Imp Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data DL_ID_Imp Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data DL_ID_Imp Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data DL_ID_Imp Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data DL_ID_Imp Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data DL_ID_Imp Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data DL_ID_ImpTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data DL_ID_Imp Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 inner_demons,if=talent.inner_demons.enabled
5 0.00 snapshot_stats
6 0.00 potion
7 0.00 demonbolt
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,if=pet.demonic_tyrant.active|target.time_to_die<30
9 2.37 use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
A 2.00 berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
0.00 demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
B 0.00 call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
C 0.00 call_action_list,name=implosion,if=spell_targets.implosion>1
0.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
D 4.87 summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
E 11.56 call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
F 1.59 summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
0.00 doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
G 46.17 hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
0.00 soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
H 42.88 demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
0.00 bilescourge_bombers
I 0.00 call_action_list,name=build_a_shard
actions.build_a_shard
# count action,conditions
0.00 demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
0.00 soul_strike
J 94.51 shadow_bolt
actions.nether_portal_active
# count action,conditions
0.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
N 2.00 summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
O 2.00 call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
P 0.00 call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
Q 14.44 hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
R 1.96 summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
S 0.04 summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
T 4.12 demonbolt,if=buff.demonic_core.up
U 0.00 call_action_list,name=build_a_shard
actions.nether_portal_building
# count action,conditions
V 2.00 nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
W 1.02 call_dreadstalkers
X 0.55 hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
Y 1.93 hand_of_guldan,if=soul_shard>=5
Z 0.00 call_action_list,name=build_a_shard

Sample Sequence

0123467VNOQJQR9AJQJQJQJQJQJQJJJJJEGHGJJHGHGHHGJHGHGHJJEJDGJJJGJHGHJJJEGHGJJJGJJHGHJJGJEHJGDHF8GJJJJJEGJJGHHGHGHHGHHGEJJGJJJHDGHGHJJEGJJJGJJJJJYJJWXJJJJJVQQTQTNJOQR9ATQJQJJJGJJJJJEGHJGHHGHGJHGHJJEDJGJJJGJHGHJJJEGHGHJGJJJGJJJHGHEGJJDJJFGJJJJJGE

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask DL_ID_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food DL_ID_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 augmentation DL_ID_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_imp Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 4 inner_demons Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 potion Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard battle_potion_of_intellect
0:00.000 precombat 7 demonbolt Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard battle_potion_of_intellect
0:00.000 nether_portal_building V nether_portal Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard archive_of_the_titans, battle_potion_of_intellect
0:01.276 nether_portal_active N summon_vilefiend Fluffy_Pillow 99276.0/100000: 99% mana | 5.0/5: 100% soul_shard bloodlust, nether_portal, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:02.585 nether_portal_active O call_dreadstalkers Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, nether_portal, vilefiend, portal_summons(2), archive_of_the_titans, battle_potion_of_intellect
0:03.893 nether_portal_active Q hand_of_guldan Fluffy_Pillow 100000.0/100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, portal_summons(3), archive_of_the_titans, battle_potion_of_intellect
0:04.875 build_a_shard J shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, portal_summons(4), archive_of_the_titans, battle_potion_of_intellect
0:06.184 nether_portal_active Q hand_of_guldan Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard bloodlust, demonic_calling, nether_portal, wild_imps, dreadstalkers(2), vilefiend, portal_summons(4), archive_of_the_titans(2), battle_potion_of_intellect
0:07.165 nether_portal_active R summon_demonic_tyrant Fluffy_Pillow 98986.0/100000: 99% mana | 0.0/5: 0% soul_shard bloodlust, demonic_calling, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, portal_summons(5), overwhelming_power(25), archive_of_the_titans(2), battle_potion_of_intellect
0:08.296 default 9 use_items Fluffy_Pillow 98003.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, demonic_calling, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), overwhelming_power(24), archive_of_the_titans(2), battle_potion_of_intellect
0:08.296 default A berserking Fluffy_Pillow 98003.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, demonic_calling, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), overwhelming_power(24), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.296 build_a_shard J shadow_bolt Fluffy_Pillow 98003.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), overwhelming_power(24), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.260 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96967.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), overwhelming_power(23), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:10.014 build_a_shard J shadow_bolt Fluffy_Pillow 97721.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), overwhelming_power(22), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:10.988 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96695.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation, overwhelming_power(22), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:11.742 build_a_shard J shadow_bolt Fluffy_Pillow 97449.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation, overwhelming_power(21), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:12.715 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96422.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(2), overwhelming_power(25), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.470 build_a_shard J shadow_bolt Fluffy_Pillow 97177.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), overwhelming_power(24), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.394 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96101.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), overwhelming_power(23), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.149 build_a_shard J shadow_bolt Fluffy_Pillow 96856.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), overwhelming_power(22), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.084 nether_portal_active Q hand_of_guldan Fluffy_Pillow 95791.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), overwhelming_power(21), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.841 build_a_shard J shadow_bolt Fluffy_Pillow 96548.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), overwhelming_power(21), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.755 nether_portal_active Q hand_of_guldan Fluffy_Pillow 95462.0/100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), overwhelming_power(20), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.510 build_a_shard J shadow_bolt Fluffy_Pillow 96217.0/100000: 96% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), overwhelming_power(19), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.572 build_a_shard J shadow_bolt Fluffy_Pillow 95279.0/100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), overwhelming_power(18), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:20.638 build_a_shard J shadow_bolt Fluffy_Pillow 94345.0/100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), overwhelming_power(17), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.680 build_a_shard J shadow_bolt Fluffy_Pillow 93387.0/100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), overwhelming_power(16), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.729 build_a_shard J shadow_bolt Fluffy_Pillow 92436.0/100000: 92% mana | 4.0/5: 80% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), overwhelming_power(15), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:23.784 default E call_dreadstalkers Fluffy_Pillow 91491.0/100000: 91% mana | 5.0/5: 100% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(10), dreadstalkers(2), vilefiend, portal_summons(8), quick_navigation(2), overwhelming_power(14), archive_of_the_titans(5), ignition_mages_fuse(4)
0:24.682 default G hand_of_guldan Fluffy_Pillow 92389.0/100000: 92% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(2), overwhelming_power(13), archive_of_the_titans(5), ignition_mages_fuse(5)
0:25.461 default H demonbolt Fluffy_Pillow 93168.0/100000: 93% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(2), overwhelming_power(12), archive_of_the_titans(6), ignition_mages_fuse(5)
0:26.242 default G hand_of_guldan Fluffy_Pillow 91949.0/100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(2), overwhelming_power(11), archive_of_the_titans(6), ignition_mages_fuse(5)
0:27.028 build_a_shard J shadow_bolt Fluffy_Pillow 92735.0/100000: 93% mana | 0.0/5: 0% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(12), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(2), overwhelming_power(10), archive_of_the_titans(6), ignition_mages_fuse(5)
0:28.077 build_a_shard J shadow_bolt Fluffy_Pillow 91784.0/100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(8), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(2), overwhelming_power(9), archive_of_the_titans(6), ignition_mages_fuse(5)
0:29.133 default H demonbolt Fluffy_Pillow 90840.0/100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(4), vilefiend, quick_navigation(2), overwhelming_power(8), archive_of_the_titans(6)
0:30.059 default G hand_of_guldan Fluffy_Pillow 89766.0/100000: 90% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(4), vilefiend, quick_navigation(2), overwhelming_power(7), archive_of_the_titans(7)
0:30.990 default H demonbolt Fluffy_Pillow 90697.0/100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core(3), demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(7), archive_of_the_titans(7)
0:31.922 default G hand_of_guldan Fluffy_Pillow 89629.0/100000: 90% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(6), archive_of_the_titans(7)
0:32.859 default H demonbolt Fluffy_Pillow 90566.0/100000: 91% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), quick_navigation(3), overwhelming_power(5), archive_of_the_titans(7)
0:33.797 default H demonbolt Fluffy_Pillow 89504.0/100000: 90% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation(3), overwhelming_power(4), archive_of_the_titans(7)
0:34.738 default G hand_of_guldan Fluffy_Pillow 88445.0/100000: 88% mana | 4.0/5: 80% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), quick_navigation(3), overwhelming_power(3), archive_of_the_titans(7)
0:35.687 build_a_shard J shadow_bolt Fluffy_Pillow 89394.0/100000: 89% mana | 1.0/5: 20% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation(3), overwhelming_power(2), archive_of_the_titans(8)
0:36.957 default H demonbolt Fluffy_Pillow 88664.0/100000: 89% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(8), quick_navigation(3), overwhelming_power, archive_of_the_titans(8)
0:37.915 default G hand_of_guldan Fluffy_Pillow 87622.0/100000: 88% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(10), quick_navigation(3), archive_of_the_titans(8)
0:38.879 default H demonbolt Fluffy_Pillow 88586.0/100000: 89% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core, demonic_calling, wild_imps(8), quick_navigation(3), archive_of_the_titans(8)
0:39.843 default G hand_of_guldan Fluffy_Pillow 87550.0/100000: 88% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, wild_imps(7), quick_navigation(3), archive_of_the_titans(8)
0:40.806 default H demonbolt Fluffy_Pillow 88513.0/100000: 89% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core, demonic_calling, wild_imps(8), quick_navigation(4), archive_of_the_titans(9)
0:41.766 build_a_shard J shadow_bolt Fluffy_Pillow 87473.0/100000: 87% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(7), quick_navigation(4), archive_of_the_titans(9)
0:43.425 build_a_shard J shadow_bolt Fluffy_Pillow 87132.0/100000: 87% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(9), quick_navigation(4), archive_of_the_titans(9)
0:45.086 default E call_dreadstalkers Fluffy_Pillow 86793.0/100000: 87% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), quick_navigation(4), archive_of_the_titans(10)
0:46.331 build_a_shard J shadow_bolt Fluffy_Pillow 88038.0/100000: 88% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(10)
0:47.992 default D summon_vilefiend Fluffy_Pillow 87699.0/100000: 88% mana | 4.0/5: 80% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(10)
0:49.651 default G hand_of_guldan Fluffy_Pillow 89358.0/100000: 89% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(10)
0:50.898 build_a_shard J shadow_bolt Fluffy_Pillow 90605.0/100000: 91% mana | 0.0/5: 0% soul_shard wild_imps(2), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(11)
0:52.557 build_a_shard J shadow_bolt Fluffy_Pillow 90264.0/100000: 90% mana | 1.0/5: 20% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(11)
0:54.215 build_a_shard J shadow_bolt Fluffy_Pillow 89922.0/100000: 90% mana | 2.0/5: 40% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(11)
0:55.874 default G hand_of_guldan Fluffy_Pillow 89581.0/100000: 90% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(25), archive_of_the_titans(12)
0:56.955 build_a_shard J shadow_bolt Fluffy_Pillow 90662.0/100000: 91% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(24), archive_of_the_titans(12)
0:58.405 default H demonbolt Fluffy_Pillow 90112.0/100000: 90% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(4), vilefiend, quick_navigation(4), overwhelming_power(22), archive_of_the_titans(12)
0:59.505 default G hand_of_guldan Fluffy_Pillow 89212.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(6), vilefiend, quick_navigation(4), overwhelming_power(21), archive_of_the_titans(12)
1:00.611 default H demonbolt Fluffy_Pillow 90318.0/100000: 90% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(4), vilefiend, quick_navigation(4), overwhelming_power(20), archive_of_the_titans(13)
1:01.723 build_a_shard J shadow_bolt Fluffy_Pillow 89430.0/100000: 89% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), vilefiend, quick_navigation(4), overwhelming_power(19), archive_of_the_titans(13)
1:03.210 build_a_shard J shadow_bolt Fluffy_Pillow 88917.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), vilefiend, quick_navigation(4), overwhelming_power(17), archive_of_the_titans(13)
1:04.713 build_a_shard J shadow_bolt Fluffy_Pillow 88420.0/100000: 88% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), quick_navigation_final, overwhelming_power(16), archive_of_the_titans(13)
1:06.161 default E call_dreadstalkers Fluffy_Pillow 87868.0/100000: 88% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(5), quick_navigation_final, overwhelming_power(14), archive_of_the_titans(14)
1:07.259 default G hand_of_guldan Fluffy_Pillow 88966.0/100000: 89% mana | 4.0/5: 80% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(13), archive_of_the_titans(14)
1:08.363 default H demonbolt Fluffy_Pillow 90070.0/100000: 90% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), quick_navigation_final, overwhelming_power(12), archive_of_the_titans(14)
1:09.471 default G hand_of_guldan Fluffy_Pillow 89178.0/100000: 89% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation_final, overwhelming_power(11), archive_of_the_titans(14)
1:10.586 build_a_shard J shadow_bolt Fluffy_Pillow 90293.0/100000: 90% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation_final, overwhelming_power(10), archive_of_the_titans(15)
1:12.083 build_a_shard J shadow_bolt Fluffy_Pillow 89790.0/100000: 90% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation_final, overwhelming_power(8), archive_of_the_titans(15)
1:13.594 build_a_shard J shadow_bolt Fluffy_Pillow 89301.0/100000: 89% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation_final, overwhelming_power(7), archive_of_the_titans(15)
1:15.114 default G hand_of_guldan Fluffy_Pillow 88821.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), overwhelming_power(5), archive_of_the_titans(16)
1:16.350 build_a_shard J shadow_bolt Fluffy_Pillow 90057.0/100000: 90% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), overwhelming_power(4), archive_of_the_titans(16)
1:18.008 build_a_shard J shadow_bolt Fluffy_Pillow 89715.0/100000: 90% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(7), dreadstalkers(2), overwhelming_power(2), archive_of_the_titans(16)
1:19.687 default H demonbolt Fluffy_Pillow 89394.0/100000: 89% mana | 2.0/5: 40% soul_shard demonic_core(4), demonic_calling, wild_imps(6), quick_navigation, overwhelming_power, archive_of_the_titans(16)
1:20.949 default G hand_of_guldan Fluffy_Pillow 88656.0/100000: 89% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, wild_imps(3), quick_navigation, archive_of_the_titans(17)
1:22.216 default H demonbolt Fluffy_Pillow 89923.0/100000: 90% mana | 1.0/5: 20% soul_shard demonic_core(3), demonic_calling, wild_imps(3), quick_navigation, archive_of_the_titans(17)
1:23.486 build_a_shard J shadow_bolt Fluffy_Pillow 89193.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation, archive_of_the_titans(17)
1:25.174 build_a_shard J shadow_bolt Fluffy_Pillow 88881.0/100000: 89% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(7), quick_navigation, archive_of_the_titans(18)
1:26.863 default G hand_of_guldan Fluffy_Pillow 88570.0/100000: 89% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation, archive_of_the_titans(18)
1:28.132 build_a_shard J shadow_bolt Fluffy_Pillow 89839.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation(2), archive_of_the_titans(18)
1:29.812 default E call_dreadstalkers Fluffy_Pillow 89519.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation(2), archive_of_the_titans(18)
1:31.072 default H demonbolt Fluffy_Pillow 90779.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(7), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(19)
1:32.331 build_a_shard J shadow_bolt Fluffy_Pillow 90038.0/100000: 90% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(19)
1:34.010 default G hand_of_guldan Fluffy_Pillow 89717.0/100000: 90% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(19)
1:35.271 default D summon_vilefiend Fluffy_Pillow 90978.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
1:36.950 default H demonbolt Fluffy_Pillow 92657.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
1:38.209 default F summon_demonic_tyrant Fluffy_Pillow 91916.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
1:39.971 default 8 potion Fluffy_Pillow 91678.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20)
1:39.971 default G hand_of_guldan Fluffy_Pillow 91678.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20), battle_potion_of_intellect
1:41.231 build_a_shard J shadow_bolt Fluffy_Pillow 92938.0/100000: 93% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:42.901 build_a_shard J shadow_bolt Fluffy_Pillow 92608.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:44.571 build_a_shard J shadow_bolt Fluffy_Pillow 92278.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:46.239 build_a_shard J shadow_bolt Fluffy_Pillow 91946.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:47.908 build_a_shard J shadow_bolt Fluffy_Pillow 91615.0/100000: 92% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:49.578 default E call_dreadstalkers Fluffy_Pillow 91285.0/100000: 91% mana | 5.0/5: 100% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:51.065 default G hand_of_guldan Fluffy_Pillow 92772.0/100000: 93% mana | 4.0/5: 80% soul_shard demonic_power, wild_imps(8), dreadstalkers(4), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:52.317 build_a_shard J shadow_bolt Fluffy_Pillow 94024.0/100000: 94% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(8), dreadstalkers(4), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:53.978 build_a_shard J shadow_bolt Fluffy_Pillow 93685.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(10), dreadstalkers(4), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:55.639 default G hand_of_guldan Fluffy_Pillow 93346.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:56.885 default H demonbolt Fluffy_Pillow 94592.0/100000: 95% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:58.130 default H demonbolt Fluffy_Pillow 93837.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(12), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:59.378 default G hand_of_guldan Fluffy_Pillow 93085.0/100000: 93% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(13), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:00.622 default H demonbolt Fluffy_Pillow 94329.0/100000: 94% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:01.868 default G hand_of_guldan Fluffy_Pillow 93575.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(11), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:03.114 default H demonbolt Fluffy_Pillow 94821.0/100000: 95% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(7), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:04.361 default H demonbolt Fluffy_Pillow 94068.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(8), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:05.605 default G hand_of_guldan Fluffy_Pillow 93312.0/100000: 93% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(10), vilefiend, quick_navigation_final, archive_of_the_titans(20)
2:06.791 default H demonbolt Fluffy_Pillow 94498.0/100000: 94% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(8), vilefiend, quick_navigation_final, archive_of_the_titans(20)
2:07.977 default H demonbolt Fluffy_Pillow 93684.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(8), quick_navigation_final, archive_of_the_titans(20)
2:09.165 default G hand_of_guldan Fluffy_Pillow 92872.0/100000: 93% mana | 5.0/5: 100% soul_shard demonic_calling, supreme_commander, wild_imps(9), quick_navigation_final, archive_of_the_titans(20)
2:10.353 default E call_dreadstalkers Fluffy_Pillow 94060.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(7), quick_navigation_final, archive_of_the_titans(20)
2:11.540 build_a_shard J shadow_bolt Fluffy_Pillow 95247.0/100000: 95% mana | 1.0/5: 20% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:13.122 build_a_shard J shadow_bolt Fluffy_Pillow 94829.0/100000: 95% mana | 2.0/5: 40% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:14.704 default G hand_of_guldan Fluffy_Pillow 94411.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), archive_of_the_titans(20)
2:15.980 build_a_shard J shadow_bolt Fluffy_Pillow 95687.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), archive_of_the_titans(20)
2:17.681 build_a_shard J shadow_bolt Fluffy_Pillow 95388.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), archive_of_the_titans(20)
2:19.380 build_a_shard J shadow_bolt Fluffy_Pillow 95087.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), archive_of_the_titans(20)
2:21.080 default H demonbolt Fluffy_Pillow 94787.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation, overwhelming_power(25), archive_of_the_titans(20)
2:22.177 default D summon_vilefiend Fluffy_Pillow 93884.0/100000: 94% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation, overwhelming_power(24), archive_of_the_titans(20)
2:23.648 default G hand_of_guldan Fluffy_Pillow 95355.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), vilefiend, quick_navigation, overwhelming_power(23), archive_of_the_titans(20)
2:24.758 default H demonbolt Fluffy_Pillow 96465.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(4), vilefiend, quick_navigation, overwhelming_power(22), archive_of_the_titans(20)
2:25.876 default G hand_of_guldan Fluffy_Pillow 95583.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(2), vilefiend, quick_navigation, overwhelming_power(21), archive_of_the_titans(20)
2:26.997 default H demonbolt Fluffy_Pillow 96704.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(4), vilefiend, quick_navigation(2), overwhelming_power(20), archive_of_the_titans(20)
2:28.120 build_a_shard J shadow_bolt Fluffy_Pillow 95827.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(5), vilefiend, quick_navigation(2), overwhelming_power(18), archive_of_the_titans(20)
2:29.632 build_a_shard J shadow_bolt Fluffy_Pillow 95339.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), vilefiend, quick_navigation(2), overwhelming_power(17), archive_of_the_titans(20)
2:31.153 default E call_dreadstalkers Fluffy_Pillow 94860.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), vilefiend, quick_navigation(2), overwhelming_power(15), archive_of_the_titans(20)
2:32.308 default G hand_of_guldan Fluffy_Pillow 96015.0/100000: 96% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(14), archive_of_the_titans(20)
2:33.470 build_a_shard J shadow_bolt Fluffy_Pillow 97177.0/100000: 97% mana | 0.0/5: 0% soul_shard wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(13), archive_of_the_titans(20)
2:35.025 build_a_shard J shadow_bolt Fluffy_Pillow 96732.0/100000: 97% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power(11), archive_of_the_titans(20)
2:36.591 build_a_shard J shadow_bolt Fluffy_Pillow 96298.0/100000: 96% mana | 2.0/5: 40% soul_shard wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power(10), archive_of_the_titans(20)
2:38.165 default G hand_of_guldan Fluffy_Pillow 95872.0/100000: 96% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power(8), archive_of_the_titans(20)
2:39.358 build_a_shard J shadow_bolt Fluffy_Pillow 97065.0/100000: 97% mana | 0.0/5: 0% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(3), overwhelming_power(7), archive_of_the_titans(20)
2:40.958 build_a_shard J shadow_bolt Fluffy_Pillow 96665.0/100000: 97% mana | 1.0/5: 20% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(3), overwhelming_power(6), archive_of_the_titans(20)
2:42.570 build_a_shard J shadow_bolt Fluffy_Pillow 96277.0/100000: 96% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(3), overwhelming_power(4), archive_of_the_titans(20)
2:44.201 build_a_shard J shadow_bolt Fluffy_Pillow 95908.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core(3), demonic_calling, wild_imps(3), quick_navigation(3), overwhelming_power(2), archive_of_the_titans(20)
2:45.851 build_a_shard J shadow_bolt Fluffy_Pillow 95558.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, wild_imps(3), quick_navigation(3), overwhelming_power, archive_of_the_titans(20)
2:47.511 nether_portal_building Y hand_of_guldan Fluffy_Pillow 95218.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_core(3), demonic_calling, wild_imps(3), quick_navigation(3), archive_of_the_titans(20)
2:48.763 build_a_shard J shadow_bolt Fluffy_Pillow 96470.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, wild_imps(3), quick_navigation(3), archive_of_the_titans(20)
2:50.432 build_a_shard J shadow_bolt Fluffy_Pillow 96139.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core(3), demonic_calling, wild_imps(3), quick_navigation(3), archive_of_the_titans(20)
2:52.102 nether_portal_building W call_dreadstalkers Fluffy_Pillow 95809.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, wild_imps(4), quick_navigation(3), archive_of_the_titans(20)
2:53.355 nether_portal_building X hand_of_guldan Fluffy_Pillow 97062.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(3), wild_imps(4), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
2:54.608 build_a_shard J shadow_bolt Fluffy_Pillow 98315.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(3), wild_imps(4), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
2:56.279 build_a_shard J shadow_bolt Fluffy_Pillow 97986.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(3), wild_imps(6), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
2:57.937 build_a_shard J shadow_bolt Fluffy_Pillow 97644.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(3), wild_imps(6), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
2:59.596 build_a_shard J shadow_bolt Fluffy_Pillow 97303.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(3), wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
3:01.256 build_a_shard J shadow_bolt Fluffy_Pillow 96963.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(3), wild_imps(4), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
3:02.916 nether_portal_building V nether_portal Fluffy_Pillow 96623.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(3), wild_imps(4), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
3:04.161 nether_portal_active Q hand_of_guldan Fluffy_Pillow 97868.0/100000: 98% mana | 5.0/5: 100% soul_shard demonic_core(2), nether_portal, wild_imps(3), portal_summons, quick_navigation(4), archive_of_the_titans(20)
3:05.406 nether_portal_active Q hand_of_guldan Fluffy_Pillow 99113.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(2), nether_portal, wild_imps, portal_summons(2), quick_navigation_final, archive_of_the_titans(20)
3:06.592 nether_portal_active T demonbolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(2), nether_portal, wild_imps(2), portal_summons(3), quick_navigation_final, archive_of_the_titans(20)
3:07.779 nether_portal_active Q hand_of_guldan Fluffy_Pillow 99187.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, nether_portal, wild_imps(5), portal_summons(3), quick_navigation_final, archive_of_the_titans(20)
3:08.966 nether_portal_active T demonbolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, nether_portal, wild_imps(5), portal_summons(4), quick_navigation_final, archive_of_the_titans(20)
3:10.154 nether_portal_active N summon_vilefiend Fluffy_Pillow 99188.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_calling, nether_portal, wild_imps(6), portal_summons(4), quick_navigation_final, archive_of_the_titans(20)
3:11.738 build_a_shard J shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard demonic_calling, nether_portal, wild_imps(7), vilefiend, portal_summons(5), quick_navigation_final, archive_of_the_titans(20)
3:13.321 nether_portal_active O call_dreadstalkers Fluffy_Pillow 98005.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, nether_portal, wild_imps(8), vilefiend, portal_summons(5), quick_navigation_final, archive_of_the_titans(20)
3:14.508 nether_portal_active Q hand_of_guldan Fluffy_Pillow 99192.0/100000: 99% mana | 1.0/5: 20% soul_shard nether_portal, wild_imps(7), dreadstalkers(2), vilefiend, portal_summons(6), quick_navigation_final, archive_of_the_titans(20)
3:15.694 nether_portal_active R summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, portal_summons(7), quick_navigation, archive_of_the_titans(20)
3:17.383 default 9 use_items Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, demonic_power, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation, archive_of_the_titans(20)
3:17.383 default A berserking Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, demonic_power, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse
3:17.383 nether_portal_active T demonbolt Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_core, demonic_power, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse
3:18.450 nether_portal_active Q hand_of_guldan Fluffy_Pillow 97071.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_power, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse
3:19.516 build_a_shard J shadow_bolt Fluffy_Pillow 98137.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_power, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse
3:20.937 nether_portal_active Q hand_of_guldan Fluffy_Pillow 97558.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse
3:22.004 build_a_shard J shadow_bolt Fluffy_Pillow 98625.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse(2)
3:23.379 build_a_shard J shadow_bolt Fluffy_Pillow 98000.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse(2)
3:24.755 build_a_shard J shadow_bolt Fluffy_Pillow 97376.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse(2)
3:26.132 default G hand_of_guldan Fluffy_Pillow 96753.0/100000: 97% mana | 3.0/5: 60% soul_shard berserking, demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse(3)
3:27.134 build_a_shard J shadow_bolt Fluffy_Pillow 97755.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse(3)
3:28.467 build_a_shard J shadow_bolt Fluffy_Pillow 97088.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse(3)
3:29.992 build_a_shard J shadow_bolt Fluffy_Pillow 96613.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse(4)
3:31.471 build_a_shard J shadow_bolt Fluffy_Pillow 96092.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse(4)
3:32.952 build_a_shard J shadow_bolt Fluffy_Pillow 95573.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core, supreme_commander, wild_imps(9), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse(4)
3:34.432 default E call_dreadstalkers Fluffy_Pillow 95053.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_core, supreme_commander, wild_imps(8), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse(5)
3:35.869 default G hand_of_guldan Fluffy_Pillow 96490.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core, supreme_commander, wild_imps(8), dreadstalkers(4), vilefiend, quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse(5)
3:36.948 default H demonbolt Fluffy_Pillow 97569.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, supreme_commander, wild_imps(9), dreadstalkers(4), vilefiend, quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse(5)
3:38.027 build_a_shard J shadow_bolt Fluffy_Pillow 96648.0/100000: 97% mana | 2.0/5: 40% soul_shard supreme_commander, wild_imps(9), dreadstalkers(4), vilefiend, quick_navigation(2), archive_of_the_titans(20)
3:39.706 default G hand_of_guldan Fluffy_Pillow 96327.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core, supreme_commander, wild_imps(4), dreadstalkers(4), vilefiend, quick_navigation(3), archive_of_the_titans(20)
3:40.961 default H demonbolt Fluffy_Pillow 97582.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(3), supreme_commander, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
3:42.214 default H demonbolt Fluffy_Pillow 96835.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), supreme_commander, wild_imps(5), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
3:43.467 default G hand_of_guldan Fluffy_Pillow 96088.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core, supreme_commander, wild_imps(7), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
3:44.719 default H demonbolt Fluffy_Pillow 97340.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
3:45.970 default G hand_of_guldan Fluffy_Pillow 96591.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
3:47.221 build_a_shard J shadow_bolt Fluffy_Pillow 97842.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
3:48.888 default H demonbolt Fluffy_Pillow 97509.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(9), quick_navigation(3), archive_of_the_titans(20)
3:50.139 default G hand_of_guldan Fluffy_Pillow 96760.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(10), quick_navigation(3), archive_of_the_titans(20)
3:51.391 default H demonbolt Fluffy_Pillow 98012.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(7), quick_navigation(3), archive_of_the_titans(20)
3:52.642 build_a_shard J shadow_bolt Fluffy_Pillow 97263.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(8), quick_navigation(3), archive_of_the_titans(20)
3:54.312 build_a_shard J shadow_bolt Fluffy_Pillow 96933.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(9), quick_navigation(4), archive_of_the_titans(20)
3:55.972 default E call_dreadstalkers Fluffy_Pillow 96593.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), quick_navigation(4), archive_of_the_titans(20)
3:57.217 default D summon_vilefiend Fluffy_Pillow 97838.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
3:58.877 build_a_shard J shadow_bolt Fluffy_Pillow 99498.0/100000: 99% mana | 2.0/5: 40% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
4:00.538 default G hand_of_guldan Fluffy_Pillow 98006.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(25), archive_of_the_titans(20)
4:01.577 build_a_shard J shadow_bolt Fluffy_Pillow 99045.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps, dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(24), archive_of_the_titans(20)
4:02.969 build_a_shard J shadow_bolt Fluffy_Pillow 98007.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(2), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(23), archive_of_the_titans(20)
4:04.365 build_a_shard J shadow_bolt Fluffy_Pillow 97403.0/100000: 97% mana | 2.0/5: 40% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(21), archive_of_the_titans(20)
4:05.776 default G hand_of_guldan Fluffy_Pillow 96814.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(20), archive_of_the_titans(20)
4:06.843 build_a_shard J shadow_bolt Fluffy_Pillow 97881.0/100000: 98% mana | 0.0/5: 0% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(19), archive_of_the_titans(20)
4:08.269 default H demonbolt Fluffy_Pillow 97307.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(4), vilefiend, quick_navigation_final, overwhelming_power(17), archive_of_the_titans(20)
4:09.350 default G hand_of_guldan Fluffy_Pillow 96388.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(6), vilefiend, quick_navigation_final, overwhelming_power(16), archive_of_the_titans(20)
4:10.437 default H demonbolt Fluffy_Pillow 97475.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(4), vilefiend, quick_navigation_final, overwhelming_power(15), archive_of_the_titans(20)
4:11.530 build_a_shard J shadow_bolt Fluffy_Pillow 96568.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), vilefiend, overwhelming_power(14), archive_of_the_titans(20)
4:13.091 build_a_shard J shadow_bolt Fluffy_Pillow 96129.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), vilefiend, overwhelming_power(12), archive_of_the_titans(20)
4:14.674 build_a_shard J shadow_bolt Fluffy_Pillow 95712.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), overwhelming_power(11), archive_of_the_titans(20)
4:16.265 default E call_dreadstalkers Fluffy_Pillow 95303.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(5), overwhelming_power(9), archive_of_the_titans(20)
4:17.473 default G hand_of_guldan Fluffy_Pillow 96511.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(4), dreadstalkers(2), overwhelming_power(8), archive_of_the_titans(20)
4:18.689 default H demonbolt Fluffy_Pillow 97727.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(4), dreadstalkers(2), quick_navigation, overwhelming_power(7), archive_of_the_titans(20)
4:19.906 default G hand_of_guldan Fluffy_Pillow 96944.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation, overwhelming_power(6), archive_of_the_titans(20)
4:21.129 default H demonbolt Fluffy_Pillow 98167.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation, overwhelming_power(4), archive_of_the_titans(20)
4:22.367 build_a_shard J shadow_bolt Fluffy_Pillow 97405.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation, overwhelming_power(3), archive_of_the_titans(20)
4:24.025 default G hand_of_guldan Fluffy_Pillow 97063.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation, overwhelming_power, archive_of_the_titans(20)
4:25.286 build_a_shard J shadow_bolt Fluffy_Pillow 98324.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation, overwhelming_power(25), archive_of_the_titans(20)
4:26.749 build_a_shard J shadow_bolt Fluffy_Pillow 97787.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(8), dreadstalkers(2), quick_navigation, overwhelming_power(24), archive_of_the_titans(20)
4:28.221 build_a_shard J shadow_bolt Fluffy_Pillow 97259.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(9), dreadstalkers(2), quick_navigation, overwhelming_power(22), archive_of_the_titans(20)
4:29.709 default G hand_of_guldan Fluffy_Pillow 96747.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(7), quick_navigation(2), overwhelming_power(21), archive_of_the_titans(20)
4:30.824 build_a_shard J shadow_bolt Fluffy_Pillow 97862.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation(2), overwhelming_power(20), archive_of_the_titans(20)
4:32.320 build_a_shard J shadow_bolt Fluffy_Pillow 97358.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation(2), overwhelming_power(25), archive_of_the_titans(20)
4:33.774 build_a_shard J shadow_bolt Fluffy_Pillow 96812.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation(2), overwhelming_power(24), archive_of_the_titans(20)
4:35.238 default H demonbolt Fluffy_Pillow 96276.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(3), overwhelming_power(22), archive_of_the_titans(20)
4:36.342 default G hand_of_guldan Fluffy_Pillow 95380.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(4), quick_navigation(3), overwhelming_power(21), archive_of_the_titans(20)
4:37.453 default H demonbolt Fluffy_Pillow 96491.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(4), quick_navigation(4), overwhelming_power(20), archive_of_the_titans(20)
4:38.562 default E call_dreadstalkers Fluffy_Pillow 95600.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(4), quick_navigation(4), overwhelming_power(19), archive_of_the_titans(20)
4:39.678 default G hand_of_guldan Fluffy_Pillow 96716.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation(4), overwhelming_power(18), archive_of_the_titans(20)
4:40.801 build_a_shard J shadow_bolt Fluffy_Pillow 97839.0/100000: 98% mana | 0.0/5: 0% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(4), overwhelming_power(17), archive_of_the_titans(20)
4:42.305 build_a_shard J shadow_bolt Fluffy_Pillow 97343.0/100000: 97% mana | 1.0/5: 20% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(4), overwhelming_power(15), archive_of_the_titans(20)
4:43.827 default D summon_vilefiend Fluffy_Pillow 96865.0/100000: 97% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(14), archive_of_the_titans(20)
4:45.335 build_a_shard J shadow_bolt Fluffy_Pillow 98373.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(12), archive_of_the_titans(20)
4:46.815 build_a_shard J shadow_bolt Fluffy_Pillow 97853.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(11), archive_of_the_titans(20)
4:48.304 default F summon_demonic_tyrant Fluffy_Pillow 97342.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(9), archive_of_the_titans(20)
4:49.808 default G hand_of_guldan Fluffy_Pillow 96846.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(8), archive_of_the_titans(20)
4:50.943 build_a_shard J shadow_bolt Fluffy_Pillow 97981.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps, dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(7), archive_of_the_titans(20)
4:52.464 build_a_shard J shadow_bolt Fluffy_Pillow 97502.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(25), archive_of_the_titans(20)
4:53.846 build_a_shard J shadow_bolt Fluffy_Pillow 96884.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation, overwhelming_power(24), archive_of_the_titans(20)
4:55.318 build_a_shard J shadow_bolt Fluffy_Pillow 96356.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation, overwhelming_power(22), archive_of_the_titans(20)
4:56.806 build_a_shard J shadow_bolt Fluffy_Pillow 95844.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation, overwhelming_power(25), archive_of_the_titans(20)
4:58.268 default G hand_of_guldan Fluffy_Pillow 95306.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation, overwhelming_power(23), archive_of_the_titans(20)
4:59.380 default E call_dreadstalkers Fluffy_Pillow 96418.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation, overwhelming_power(22), archive_of_the_titans(20)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 9026 8206 7205
Intellect 1467 -3 8475 7287 5476 (377)
Spirit 0 0 0 0 0
Health 180520 164120 0
Mana 100000 100000 0
Soul Shard 5 5 0
Spell Power 8475 7287 0
Crit 17.68% 17.68% 913
Haste 17.90% 17.90% 1217
Damage / Heal Versatility 1.52% 1.52% 129
ManaReg per Second 1000 1000 0
Mastery 26.55% 26.55% 742
Armor 1159 1159 1159
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Horrific Amalgam's Hood
ilevel: 390, stats: { 154 Armor, +655 Int, +1189 Sta }
azerite powers: { Supreme Commander, Overwhelming Power, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Amice of Corrupting Horror
ilevel: 390, stats: { 142 Armor, +491 Int, +892 Sta }
azerite powers: { Archive of the Titans, Heed My Call, Azerite Empowered }
Local Chest Robes of the Unraveler
ilevel: 390, stats: { 189 Armor, +655 Int, +1189 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Azerite Empowered }
Local Waist Cord of Septic Envelopment
ilevel: 385, stats: { 103 Armor, +247 Int, +417 Sta, +115 Haste, +68 Crit }
Local Legs Leggings of Lingering Infestation
ilevel: 385, stats: { 160 Armor, +329 Int, +556 Sta, +133 Haste, +112 Mastery }
Local Feet Volatile Walkers
ilevel: 385, stats: { 126 Armor, +247 Int, +417 Sta, +111 Crit, +72 Vers }
Local Wrists Void-Lashed Wristband
ilevel: 385, stats: { 80 Armor, +185 Int, +312 Sta, +81 Mastery, +57 Vers }
Local Hands Mutagenic Protofluid Handwraps
ilevel: 385, stats: { 114 Armor, +247 Int, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 370, stats: { +271 Int }
Local Trinket2 Vigilant's Bloodshaper
ilevel: 385, stats: { +313 Int }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Tusk of the Reborn Prophet
ilevel: 385, weapon: { 126 - 211, 1.8 }, stats: { +164 Int, +277 Sta, +70 Crit, +51 Haste, +792 Int }, enchant: quick_navigation
Local Off Hand Codex of Imminent Ruin
ilevel: 385, stats: { +277 Sta, +66 Haste, +56 Mastery, +503 Int }

Talents

Level
15 Dreadlash (Demonology Warlock) Demonic Strength (Demonology Warlock) Bilescourge Bombers (Demonology Warlock)
30 Demonic Calling (Demonology Warlock) Power Siphon (Demonology Warlock) Doom (Demonology Warlock)
45 Demon Skin Burning Rush Dark Pact
60 From the Shadows (Demonology Warlock) Soul Strike (Demonology Warlock) Summon Vilefiend (Demonology Warlock)
75 Darkfury Mortal Coil Demonic Circle
90 Soul Conduit (Demonology Warlock) Inner Demons (Demonology Warlock) Grimoire: Felguard (Demonology Warlock)
100 Sacrificed Souls (Demonology Warlock) Demonic Consumption (Demonology Warlock) Nether Portal (Demonology Warlock)

Profile

warlock="DL_ID_Imp"
source=default
spec=demonology
level=120
race=troll
role=spell
position=ranged_back
talents=1103023

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/inner_demons,if=talent.inner_demons.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/demonbolt

# Executed every time the actor is available.
actions=potion,if=pet.demonic_tyrant.active|target.time_to_die<30
actions+=/use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
actions+=/demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
actions+=/call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
actions+=/call_action_list,name=implosion,if=spell_targets.implosion>1
actions+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions+=/summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions+=/call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions+=/summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
actions+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
actions+=/doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
actions+=/hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
actions+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
actions+=/bilescourge_bombers
actions+=/call_action_list,name=build_a_shard

actions.build_a_shard=demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
actions.build_a_shard+=/soul_strike
actions.build_a_shard+=/shadow_bolt

actions.implosion=implosion,if=(buff.wild_imps.stack>=6&(soul_shard<3|prev_gcd.1.call_dreadstalkers|buff.wild_imps.stack>=9|prev_gcd.1.bilescourge_bombers|(!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan))&!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan&buff.demonic_power.down)|(time_to_die<3&buff.wild_imps.stack>0)|(prev_gcd.2.call_dreadstalkers&buff.wild_imps.stack>2&!talent.demonic_calling.enabled)
actions.implosion+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.implosion+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.implosion+=/summon_demonic_tyrant
actions.implosion+=/hand_of_guldan,if=soul_shard>=5
actions.implosion+=/hand_of_guldan,if=soul_shard>=3&(((prev_gcd.2.hand_of_guldan|buff.wild_imps.stack>=3)&buff.wild_imps.stack<9)|cooldown.summon_demonic_tyrant.remains<=gcd*2|buff.demonic_power.remains>gcd*2)
actions.implosion+=/demonbolt,if=prev_gcd.1.hand_of_guldan&soul_shard>=1&(buff.wild_imps.stack<=3|prev_gcd.3.hand_of_guldan)&soul_shard<4&buff.demonic_core.up
actions.implosion+=/summon_vilefiend,if=(cooldown.summon_demonic_tyrant.remains>40&spell_targets.implosion<=2)|cooldown.summon_demonic_tyrant.remains<12
actions.implosion+=/bilescourge_bombers,if=cooldown.summon_demonic_tyrant.remains>9
actions.implosion+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions.implosion+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&(buff.demonic_core.stack>=3|buff.demonic_core.remains<=gcd*5.7)
actions.implosion+=/doom,cycle_targets=1,max_cycle_targets=7,if=refreshable
actions.implosion+=/call_action_list,name=build_a_shard

actions.nether_portal=call_action_list,name=nether_portal_building,if=cooldown.nether_portal.remains<20
actions.nether_portal+=/call_action_list,name=nether_portal_active,if=cooldown.nether_portal.remains>160

actions.nether_portal_active=grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.nether_portal_active+=/summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions.nether_portal_active+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.nether_portal_active+=/call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
actions.nether_portal_active+=/hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
actions.nether_portal_active+=/demonbolt,if=buff.demonic_core.up
actions.nether_portal_active+=/call_action_list,name=build_a_shard

actions.nether_portal_building=nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
actions.nether_portal_building+=/call_dreadstalkers
actions.nether_portal_building+=/hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
actions.nether_portal_building+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
actions.nether_portal_building+=/hand_of_guldan,if=soul_shard>=5
actions.nether_portal_building+=/call_action_list,name=build_a_shard

head=horrific_amalgams_hood,id=160616,bonus_id=4824/1507/4775,azerite_powers=458/30/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536,azerite_level=33
shoulders=amice_of_corrupting_horror,id=160726,bonus_id=4824/1507/4775,azerite_powers=483/22/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=robes_of_the_unraveler,id=160614,bonus_id=4824/1507/4775,azerite_powers=483/30/13
wrists=voidlashed_wristband,id=160617,bonus_id=4800/1507
hands=mutagenic_protofluid_handwraps,id=160715,bonus_id=4800/1507
waist=cord_of_septic_envelopment,id=160727,bonus_id=4800/1507
legs=leggings_of_lingering_infestation,id=160615,bonus_id=4800/1507
feet=volatile_walkers,id=160714,bonus_id=4800/1507
finger1=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=ignition_mages_fuse,id=159615,bonus_id=1542/4779
trinket2=vigilants_bloodshaper,id=160651,bonus_id=4800/1507
main_hand=tusk_of_the_reborn_prophet,id=160691,bonus_id=4800/1507,enchant=quick_navigation
off_hand=codex_of_imminent_ruin,id=160696,bonus_id=4800/1507

# Gear Summary
# gear_ilvl=385.25
# gear_stamina=7205
# gear_intellect=5476
# gear_crit_rating=913
# gear_haste_rating=1217
# gear_mastery_rating=742
# gear_versatility_rating=129
# gear_armor=1159
default_pet=Imp

DStr_GF_Felguard : 16975 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
16975.1 16975.1 15.8 / 0.093% 2223.5 / 13.1% 4.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
940.5 932.1 Mana 0.00% 47.4 100.0% 100%
Talents
  • 15: Demonic Strength (Demonology Warlock)
  • 30: Demonic Calling (Demonology Warlock)
  • 60: Summon Vilefiend (Demonology Warlock)
  • 90: Grimoire: Felguard (Demonology Warlock)
  • 100: Nether Portal (Demonology Warlock)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
DStr_GF_Felguard 16975
Demonbolt 1231 7.3% 43.4 6.31sec 8507 7470 Direct 44.3 7099 14199 8347 17.6%  

Stats details: demonbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.43 44.27 0.00 0.00 1.1389 0.0000 369468.33 369468.33 0.00 7469.59 7469.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.49 82.43% 7099.12 6520 8308 7100.17 6926 7320 259032 259032 0.00
crit 7.78 17.57% 14199.41 13040 16616 14198.24 13040 16616 110436 110436 0.00
 
 

Action details: demonbolt

Static Values
  • id:264178
  • school:shadowflame
  • resource:mana
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:264178
  • name:Demonbolt
  • school:shadowflame
  • tooltip:
  • description:Send the fiery soul of a fallen demon at the enemy, causing {$s1=0} Shadowflame damage.$?c2[ |cFFFFFFFFGenerates 2 Soul Shards.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.667000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Hand of Gul'dan 1023 6.0% 59.2 4.98sec 5182 4710 Direct 59.1 4416 8850 5193 17.5%  

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.24 59.11 0.00 0.00 1.1003 0.0000 306988.75 306988.75 0.00 4710.15 4710.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.75 82.47% 4416.22 1634 5979 4409.41 3950 4761 215295 215295 0.00
crit 10.36 17.53% 8849.55 3267 11958 8837.08 0 10884 91693 91693 0.00
 
 

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadowflame
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.7000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:2.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadowflame
  • tooltip:
  • description:Calls down a demonic meteor full of Wild Imps which burst forth to attack the target. Deals up to ${$m1*$86040m1} Shadowflame damage on impact to all enemies within $86040A1 yds of the target{$?s196283=false}[, applies Doom to each target,][] and summons up to ${$m1*{$104317m2=0}} Wild Imps, based on Soul Shards consumed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.160000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Heed My Call 141 (202) 0.8% (1.2%) 7.3 37.03sec 8285 0 Direct 7.3 4925 9849 5797 17.7%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.30 7.30 0.00 0.00 0.0000 0.0000 42315.88 42315.88 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.01 82.29% 4924.62 4925 4925 4922.65 0 4925 29582 29582 0.00
crit 1.29 17.71% 9849.24 9849 9849 7183.50 0 9849 12734 12734 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4620.00
  • base_dd_max:4620.00
 
    Heed My Call (_aoe) 61 0.4% 7.3 37.03sec 2489 0 Direct 7.3 2111 4221 2489 17.9%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.30 7.30 0.00 0.00 0.0000 0.0000 18165.78 18165.78 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.99 82.09% 2110.55 2111 2111 2109.71 0 2111 12648 12648 0.00
crit 1.31 17.91% 4221.10 4221 4221 3096.38 0 4221 5518 5518 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1980.00
  • base_dd_max:1980.00
 
Shadow Bolt 1303 7.7% 93.0 3.13sec 4201 2814 Direct 92.4 3592 7185 4231 17.8%  

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.04 92.38 0.00 0.00 1.4929 0.0000 390858.16 390858.16 0.00 2814.01 2814.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.96 82.22% 3592.16 3335 4297 3592.77 3545 3654 272863 272863 0.00
crit 16.42 17.78% 7184.76 6670 8595 7186.48 6922 7542 117995 117995 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=0} Shadow damage.$?c2[ |cFFFFFFFFGenerates 1 Soul Shard.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.345000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Volatile Blood Explosion 289 1.7% 7.3 36.98sec 11879 0 Direct 7.2 10240 20481 12045 17.6%  

Stats details: volatile_blood_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.30 7.20 0.00 0.00 0.0000 0.0000 86731.35 86731.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.93 82.39% 10240.44 10240 10240 10238.39 0 10240 60765 60765 0.00
crit 1.27 17.61% 20480.88 20481 20481 14954.03 0 20481 25967 25967 0.00
 
 

Action details: volatile_blood_explosion

Static Values
  • id:278057
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278057
  • name:Volatile Blood Explosion
  • school:shadow
  • tooltip:
  • description:Your damaging spells have a chance to launch an orb of charged blood at your target, dealing {$s1=4788} Shadow damage split among all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9607.38
  • base_dd_max:9607.38
 
pet - felguard 3246 / 3246
(demonic_strength_) Felstorm 793 4.7% 5.4 60.73sec 43776 11421 Periodic 32.4 6242 12480 7343 17.6% 6.9%

Stats details: demonic_strength_felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.43 0.00 32.35 32.35 3.8333 0.6430 237561.23 339622.31 30.05 11420.66 11420.66
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.6 82.36% 6242.40 5816 7641 6239.59 6002 6537 166330 237789 30.05
crit 5.7 17.64% 12480.35 11633 15282 12438.44 0 15039 71231 101833 29.97
 
 

Action details: demonic_strength_felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $ Physical damage every $t1 sec. Unable to use other abilities.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc89751=The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Felstorm 367 2.2% 10.2 30.59sec 10829 2856 Periodic 60.6 1546 3094 1816 17.4% 12.8%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.16 0.00 60.61 60.61 3.7918 0.6360 110071.79 157360.84 30.05 2855.89 2855.89
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.0 82.56% 1546.35 1428 1910 1546.39 1514 1595 77372 110612 30.05
crit 10.6 17.44% 3093.57 2856 3820 3093.30 2942 3381 32700 46749 30.05
 
 

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $ Physical damage every $t1 sec. Unable to use other abilities.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc89751=The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Legion Strike 972 5.7% 53.2 5.53sec 5472 5448 Direct 53.2 4647 9300 5472 17.7%  

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.21 53.21 0.00 0.00 1.0045 0.0000 291148.39 416231.59 30.05 5447.52 5447.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.77 82.27% 4647.29 4179 5592 4648.41 4489 4777 203433 290832 30.05
crit 9.43 17.73% 9299.68 8359 11183 9301.86 8534 10863 87715 125400 30.05
 
 

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy>=100
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w2%.
  • description:A strong attack that deals $<damage> damage to all enemies in front of it, and reduces the effectiveness of any healing the victim receives by {$s2=10}% for {$d=6 seconds}. |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1114 6.6% 161.1 1.82sec 2072 1405 Direct 161.1 1760 3519 2072 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 161.09 161.09 0.00 0.00 1.4747 0.0000 333825.11 477243.08 30.05 1405.24 1405.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 132.46 82.23% 1759.61 1586 2122 1760.00 1731 1796 233086 333225 30.05
crit 28.63 17.77% 3518.79 3173 4245 3519.62 3344 3753 100739 144018 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - grimoire_felguard 4423 / 955
Felstorm 708 0.9% 3.9 80.69sec 11570 3953 Periodic 19.4 1992 3984 2341 17.5% 3.8%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.93 0.00 19.43 19.43 2.9271 0.5923 45479.58 65018.52 30.05 3952.68 3952.68
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.0 82.46% 1991.51 1864 2388 1992.29 1929 2182 31906 45613 30.05
crit 3.4 17.54% 3983.82 3728 4775 3883.60 0 4775 13574 19405 29.28
 
 

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $ Physical damage every $t1 sec. Unable to use other abilities.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc89751=The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Legion Strike 2005 2.5% 18.4 13.86sec 6994 6994 Direct 18.4 5947 11896 6994 17.6%  

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.41 18.41 0.00 0.00 1.0000 0.0000 128758.61 184075.89 30.05 6993.95 6993.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.17 82.40% 5946.85 5456 6990 5949.86 5677 6524 90223 128984 30.05
crit 3.24 17.60% 11895.95 10913 13979 11521.67 0 13505 38536 55092 29.08
 
 

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy>=100
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w2%.
  • description:A strong attack that deals $<damage> damage to all enemies in front of it, and reduces the effectiveness of any healing the victim receives by {$s2=10}% for {$d=6 seconds}. |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1709 2.2% 40.9 6.34sec 2679 2267 Direct 40.9 2278 4556 2679 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.93 40.93 0.00 0.00 1.1819 0.0000 109657.68 156768.82 30.05 2267.11 2267.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.71 82.37% 2277.89 2071 2653 2278.60 2211 2428 76794 109786 30.05
crit 7.21 17.63% 4555.95 4142 5306 4557.38 0 5162 32864 46983 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - urzul 1338 / 179
Many Faced Bite 497 0.4% 9.4 12.29sec 2108 2108 Direct 9.4 1792 3583 2108 17.6%  

Stats details: many_faced_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.36 9.36 0.00 0.00 1.0000 0.0000 19742.59 28224.40 30.05 2108.35 2108.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.71 82.37% 1792.47 1586 1935 1792.69 0 1935 13827 19768 30.01
crit 1.65 17.63% 3583.43 3172 3870 2710.71 0 3870 5915 8457 22.72
 
 

Action details: many_faced_bite

Static Values
  • id:272439
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272439
  • name:Many Faced Bite
  • school:physical
  • tooltip:
  • description:The Ur'zul rears up and bites its target, dealing Physical damage. You're not sure which face actually bit you after thinking about it.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 841 0.7% 42.4 2.63sec 782 668 Direct 42.4 664 1328 782 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.44 42.44 0.00 0.00 1.1699 0.0000 33182.08 47437.77 30.05 668.35 668.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.91 82.27% 664.11 587 717 665.00 587 715 23186 33147 30.05
crit 7.53 17.73% 1328.10 1175 1433 1312.88 0 1433 9996 14291 29.66
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - vicious_hellhound 1063 / 142
Demon Fangs 655 0.5% 9.2 12.73sec 2816 2816 Direct 9.2 2392 4778 2816 17.8%  

Stats details: demon_fangs

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.22 9.22 0.00 0.00 1.0000 0.0000 25953.41 25953.41 0.00 2816.13 2816.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.58 82.22% 2391.73 2116 2582 2391.12 0 2582 18125 18125 0.00
crit 1.64 17.78% 4777.89 4233 5163 3601.69 0 5163 7829 7829 0.00
 
 

Action details: demon_fangs

Static Values
  • id:272013
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272013
  • name:Demon Fangs
  • school:shadowflame
  • tooltip:
  • description:The Vicious Hellhound chomps at its target, dealing Shadowflame damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 408 0.3% 82.0 1.37sec 196 326 Direct 82.0 166 332 196 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.01 82.01 0.00 0.00 0.5995 0.0000 16042.61 22934.84 30.05 326.27 326.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.52 82.33% 166.24 147 179 166.35 147 177 11224 16046 30.05
crit 14.49 17.67% 332.45 294 358 332.18 0 358 4819 6889 30.01
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - vilefiend 3187 / 1517
Bile Spit 1150 3.2% 6.7 47.39sec 24241 0 Direct 6.7 8903 17819 10488 17.8%  
Periodic 32.9 2819 0 2819 0.0% 22.0%

Stats details: bile_spit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.74 6.73 32.94 32.94 0.0000 2.0000 163415.98 163415.98 0.00 2480.55 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.53 82.22% 8902.77 8505 10104 8899.99 0 9571 49244 49244 0.00
crit 1.20 17.78% 17819.49 17011 20207 13089.43 0 20207 21316 21316 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.9 100.00% 2819.00 2502 3310 2819.90 2633 2886 92856 92856 0.00
 
 

Action details: bile_spit

Static Values
  • id:267997
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:65.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267997
  • name:Bile Spit
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:The Vilefiend spits a ball of bile at its target, dealing ${$m1*$<demoMastery>} Nature damage and an additional ${$m2*$<demoMastery>} Nature damage every $t2 sec for {$d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.680000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.200000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Headbutt 733 2.1% 28.7 10.14sec 3649 3649 Direct 28.7 3107 6215 3649 17.4%  

Stats details: headbutt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.71 28.71 0.00 0.00 1.0000 0.0000 104760.46 149767.66 30.05 3649.05 3649.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.70 82.56% 3106.85 2737 3621 3108.46 2972 3273 73640 105277 30.05
crit 5.01 17.44% 6215.30 5474 7243 6182.91 0 7243 31121 44491 29.88
 
 

Action details: headbutt

Static Values
  • id:267999
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267999
  • name:Headbutt
  • school:physical
  • tooltip:
  • description:The Vilefiend rams its bladed head into the target, dealing {$s1=0} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1304 3.7% 103.4 2.79sec 1800 1351 Direct 103.4 1529 3058 1800 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.41 103.41 0.00 0.00 1.3322 0.0000 186122.45 266084.40 30.05 1351.07 1351.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 85.10 82.30% 1529.29 1342 1775 1529.90 1479 1568 130146 186060 30.05
crit 18.30 17.70% 3058.29 2683 3550 3059.66 2825 3408 55976 80025 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - shivarra 1956 / 263
melee 845 0.7% 42.9 2.67sec 782 668 Direct 42.9 664 1328 782 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.93 42.93 0.00 0.00 1.1701 0.0000 33546.34 47958.52 30.05 667.93 667.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.31 82.26% 663.80 587 717 664.68 587 714 23440 33510 30.05
crit 7.61 17.74% 1327.54 1175 1433 1307.64 0 1433 10106 14448 29.57
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 423 0.3% 42.9 2.67sec 391 316 Direct 42.9 332 664 391 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.93 42.93 0.00 0.00 1.2375 0.0000 16769.28 23973.70 30.05 315.68 315.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.32 82.29% 331.90 294 358 332.33 294 357 11724 16761 30.05
crit 7.60 17.71% 663.77 587 717 656.06 0 717 5045 7213 29.67
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Multi-Slash 0 (93) 0.0% (0.5%) 0.0 0.00sec 0 3972

Stats details: multislash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 3971.54 3971.54
 
 

Action details: multislash

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (1) 172 0.1% 6.9 17.88sec 994 0 Direct 6.9 843 1686 994 17.8%  

Stats details: multislash1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.90 6.90 0.00 0.00 0.0000 0.0000 6860.44 9807.83 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.67 82.17% 843.33 749 914 840.88 0 914 4784 6840 29.91
crit 1.23 17.83% 1686.22 1498 1827 1139.73 0 1827 2076 2968 20.31
 
 

Action details: multislash1

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (2) 173 0.1% 6.9 17.88sec 995 0 Direct 6.9 844 1684 995 18.1%  

Stats details: multislash2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.90 6.90 0.00 0.00 0.0000 0.0000 6872.88 9825.60 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.66 81.93% 843.55 749 914 840.00 0 914 4772 6822 29.87
crit 1.25 18.07% 1684.15 1498 1827 1154.45 0 1827 2101 3004 20.58
 
 

Action details: multislash2

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (3) 171 0.1% 6.9 17.88sec 991 0 Direct 6.9 843 1686 991 17.5%  

Stats details: multislash3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.90 6.90 0.00 0.00 0.0000 0.0000 6839.56 9777.97 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.70 82.52% 843.37 749 914 842.32 0 914 4805 6869 29.96
crit 1.21 17.48% 1685.79 1498 1827 1137.55 0 1827 2034 2908 20.26
 
 

Action details: multislash3

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (4) 172 0.1% 6.9 17.88sec 992 0 Direct 6.9 843 1687 992 17.6%  

Stats details: multislash4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.90 6.90 0.00 0.00 0.0000 0.0000 6846.64 9788.10 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.69 82.41% 843.26 749 914 840.64 0 914 4798 6859 29.90
crit 1.21 17.59% 1686.81 1498 1827 1143.77 0 1827 2049 2929 20.36
 
 

Action details: multislash4

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - dreadstalker 3373 / 2226
Dreadbite 1064 4.1% 29.0 20.95sec 7260 0 Direct 29.0 6174 12336 7260 17.6%  

Stats details: dreadbite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.99 28.99 0.00 0.00 0.0000 0.0000 210449.95 210449.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.88 82.38% 6174.08 5732 7613 6174.55 5939 6387 147426 147426 0.00
crit 5.11 17.62% 12336.34 11464 15227 12281.99 0 15227 63024 63024 0.00
 
 

Action details: dreadbite

Static Values
  • id:205196
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205196
  • name:Dreadbite
  • school:shadow
  • tooltip:
  • description:Bite the target, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 2309 9.0% 312.4 1.88sec 1463 1106 Direct 312.4 1244 2487 1463 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 312.35 312.35 0.00 0.00 1.3234 0.0000 457094.98 653472.17 30.05 1105.80 1105.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 257.12 82.32% 1243.50 1101 1473 1243.69 1228 1263 319725 457086 30.05
crit 55.24 17.68% 2486.87 2203 2947 2487.18 2385 2611 137370 196386 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.83
 
pet - darkhound 1315 / 175
Fel Bite 470 0.4% 8.8 13.56sec 2113 2113 Direct 8.8 1794 3588 2113 17.8%  

Stats details: fel_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.81 8.81 0.00 0.00 1.0000 0.0000 18625.74 26627.74 30.05 2113.20 2113.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.25 82.21% 1793.98 1586 1935 1793.19 0 1935 13000 18585 29.97
crit 1.57 17.79% 3588.15 3172 3870 2679.56 0 3870 5626 8043 22.42
 
 

Action details: fel_bite

Static Values
  • id:272435
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272435
  • name:Fel Bite
  • school:physical
  • tooltip:
  • description:The Darkhound bites its target, causing serious Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 845 0.7% 42.3 2.74sec 781 666 Direct 42.3 664 1328 781 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.34 42.34 0.00 0.00 1.1724 0.0000 33068.93 47276.00 30.05 666.23 666.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.86 82.34% 663.73 587 717 664.66 587 714 23138 33079 30.05
crit 7.48 17.66% 1328.39 1175 1433 1313.59 0 1433 9931 14197 29.67
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - demonic_tyrant 4660 / 821
Demonfire 4660 4.8% 37.6 6.92sec 6526 4890 Direct 37.6 5561 11127 6541 17.6%  

Stats details: demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.64 37.55 0.00 0.00 1.3345 0.0000 245615.74 245615.74 0.00 4889.92 4889.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.95 82.41% 5561.38 5029 5917 5564.73 5459 5681 172103 172103 0.00
crit 6.61 17.59% 11126.62 10059 11834 11106.92 0 11834 73513 73513 0.00
 
 

Action details: demonfire

Static Values
  • id:270481
  • school:shadowflame
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:270481
  • name:Demonfire
  • school:shadowflame
  • tooltip:
  • description:Deal {$s1=0} Shadowflame damage to your enemy target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.357500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - wild_imp 2554 / 2433
Fel Firebolt 2554 14.4% 977.2 0.30sec 747 502 Direct 973.1 637 1274 750 17.7%  

Stats details: fel_firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 977.21 973.13 0.00 0.00 1.4865 0.0000 729776.57 729776.57 0.00 502.38 502.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 801.07 82.32% 637.25 569 761 637.29 624 648 510487 510487 0.00
crit 172.06 17.68% 1274.49 1138 1523 1274.52 1231 1311 219290 219290 0.00
 
 

Action details: fel_firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Fel Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.046000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - void_terror 1839 / 249
Double Breath 0 (135) 0.0% (0.8%) 0.0 0.00sec 0 7394

Stats details: double_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 7393.91 7393.91
 
 

Action details: double_breath

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (1) 495 0.4% 7.1 17.31sec 2800 0 Direct 7.1 2385 4772 2800 17.4%  

Stats details: double_breath1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.11 7.11 0.00 0.00 0.0000 0.0000 19893.90 19893.90 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.87 82.63% 2385.14 2116 2582 2380.50 0 2582 14003 14003 0.00
crit 1.23 17.37% 4771.99 4233 5163 3212.38 0 5163 5891 5891 0.00
 
 

Action details: double_breath1

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (2) 497 0.4% 7.1 17.31sec 2807 0 Direct 7.1 2385 4773 2807 17.7%  

Stats details: double_breath2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.11 7.11 0.00 0.00 0.0000 0.0000 19944.46 19944.46 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.85 82.33% 2385.01 2116 2582 2382.33 0 2582 13952 13952 0.00
crit 1.26 17.67% 4773.15 4233 5163 3270.30 0 5163 5993 5993 0.00
 
 

Action details: double_breath2

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
melee 847 0.7% 43.2 2.67sec 781 666 Direct 43.2 664 1327 781 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.19 43.19 0.00 0.00 1.1739 0.0000 33754.91 48256.69 30.05 665.74 665.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.52 82.23% 663.56 587 717 664.39 587 715 23567 33692 30.05
crit 7.68 17.77% 1327.07 1175 1433 1308.15 0 1433 10188 14565 29.58
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - illidari_satyr 1272 / 170
melee 420 0.3% 42.4 2.65sec 390 332 Direct 42.4 332 663 390 17.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.44 42.44 0.00 0.00 1.1729 0.0000 16543.84 23651.40 30.05 332.35 332.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.02 82.52% 331.83 294 358 332.18 294 357 11621 16614 30.05
crit 7.42 17.48% 663.49 587 717 653.75 0 717 4922 7037 29.58
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 211 0.2% 42.4 2.65sec 195 158 Direct 42.4 166 332 195 17.8%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.44 42.44 0.00 0.00 1.2406 0.0000 8294.21 11857.57 30.05 157.53 157.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.89 82.21% 165.90 147 179 166.08 147 179 5788 8275 30.05
crit 7.55 17.79% 331.94 294 358 327.45 0 358 2506 3582 29.62
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Shadow Slash 641 0.5% 9.1 12.70sec 2813 2813 Direct 9.1 2394 4790 2813 17.5%  

Stats details: shadow_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.05 9.05 0.00 0.00 1.0000 0.0000 25462.74 25462.74 0.00 2813.25 2813.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.47 82.50% 2393.51 2116 2582 2389.56 0 2582 17874 17874 0.00
crit 1.58 17.50% 4790.03 4233 5163 3584.99 0 5163 7589 7589 0.00
 
 

Action details: shadow_slash

Static Values
  • id:272012
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272012
  • name:Shadow Slash
  • school:shadow
  • tooltip:
  • description:The Satyr strikes at out with its weapons, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - bilescourge 3892 / 520
Toxic Bile 3892 3.0% 54.4 2.09sec 2821 3035 Direct 54.4 2397 4794 2821 17.7%  

Stats details: toxic_bile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.42 54.42 0.00 0.00 0.9293 0.0000 153515.29 153515.29 0.00 3035.46 3035.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.80 82.32% 2396.75 2116 2582 2399.02 2116 2572 107375 107375 0.00
crit 9.62 17.68% 4794.20 4233 5163 4772.43 0 5163 46141 46141 0.00
 
 

Action details: toxic_bile

Static Values
  • id:272167
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272167
  • name:Toxic Bile
  • school:nature
  • tooltip:
  • description:The Bilescourge spits wads of Toxic Bile at its target, dealing Nature damage.
 
pet - wrathguard 1731 / 231
melee 841 0.7% 42.6 2.62sec 782 669 Direct 42.6 664 1328 782 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.56 42.56 0.00 0.00 1.1686 0.0000 33259.04 47547.79 30.05 668.81 668.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.02 82.29% 664.03 587 717 664.97 587 714 23254 33245 30.05
crit 7.54 17.71% 1327.52 1175 1433 1309.16 0 1433 10005 14303 29.60
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 421 0.3% 42.6 2.62sec 391 316 Direct 42.6 332 664 391 17.8%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.56 42.56 0.00 0.00 1.2362 0.0000 16644.86 23795.83 30.05 316.38 316.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.98 82.20% 331.96 294 358 332.42 294 357 11612 16601 30.05
crit 7.58 17.80% 664.25 587 717 655.87 0 717 5033 7195 29.64
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Overhead Assault 468 0.4% 8.8 13.12sec 2109 2109 Direct 8.8 1795 3585 2109 17.5%  

Stats details: overhead_assault

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.85 8.85 0.00 0.00 1.0000 0.0000 18660.60 26677.57 30.05 2109.02 2109.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.30 82.45% 1794.63 1586 1935 1794.08 0 1935 13093 18719 29.97
crit 1.55 17.55% 3584.90 3172 3870 2661.81 0 3870 5567 7959 22.29
 
 

Action details: overhead_assault

Static Values
  • id:272432
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272432
  • name:Overhead Assault
  • school:physical
  • tooltip:
  • description:The Wrathguard smashes its target with a heavy overhand swing.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - prince_malchezaar 4733 / 407
melee 3156 1.6% 21.5 1.58sec 3699 3167 Direct 21.5 3145 6294 3699 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.54 21.54 0.00 0.00 1.1680 0.0000 79672.27 113901.08 30.05 3167.25 3167.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.74 82.39% 3144.58 2784 3396 3151.38 2784 3382 55796 79767 30.05
crit 3.79 17.61% 6293.64 5567 6791 6056.29 0 6791 23876 34134 28.85
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 1578 0.8% 21.5 1.58sec 1847 1496 Direct 21.5 1573 3145 1847 17.5%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.54 21.54 0.00 0.00 1.2349 0.0000 39789.07 56883.25 30.05 1496.05 1496.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.77 82.51% 1572.53 1392 1698 1576.29 1392 1693 27945 39951 30.05
crit 3.77 17.49% 3144.57 2784 3396 3019.49 0 3396 11844 16932 28.80
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - eye_of_guldan 973 / 82
Eye of Gul'dan 973 0.5% 27.9 4.42sec 864 1137 Periodic 60.2 401 0 401 0.0% 59.0%

Stats details: eye_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.91 0.00 60.16 60.16 0.7592 2.9410 24098.84 24098.84 0.00 121.65 1137.44
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.2 100.00% 400.61 182 461 399.77 379 410 24099 24099 0.00
 
 

Action details: eye_of_guldan

Static Values
  • id:272131
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272131
  • name:Eye of Gul'dan
  • school:shadowflame
  • tooltip:Suffering Shadow damage every $t1 sec.
  • description:The Eye of Gul'dan stares deep into the target's soul, causing Shadow Damage every $t1 sec for {$d=15 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.300000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
DStr_GF_Felguard
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_GF_Felguard
  • harmful:false
  • if_expr:
 
Berserking 2.0 187.80sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:pet.demonic_tyrant.active|target.time_to_die<=15
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Call Dreadstalkers 14.5 20.95sec

Stats details: call_dreadstalkers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.55 0.00 0.00 0.00 1.2043 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: call_dreadstalkers

Static Values
  • id:104316
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:20.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
Spelldata
  • id:104316
  • name:Call Dreadstalkers
  • school:shadow
  • tooltip:
  • description:Summons {$s1=2} ferocious Dreadstalkers to attack the target for {$193332d=12 seconds}.
 
Demonic Strength 5.5 60.48sec

Stats details: demonic_strength

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.47 0.00 0.00 0.00 1.2162 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: demonic_strength

Static Values
  • id:267171
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
Spelldata
  • id:267171
  • name:Demonic Strength
  • school:shadow
  • tooltip:Your next Felstorm will deal {$s2=400}% increased damage.
  • description:Infuse your Felguard with demonic strength and command it to charge your target and unleash a Felstorm that will deal {$s2=400}% increased damage.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_GF_Felguard
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_GF_Felguard
  • harmful:false
  • if_expr:
 
Grimoire: Felguard 3.0 120.76sec

Stats details: grimoire_felguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 1.1277 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: grimoire_felguard

Static Values
  • id:111898
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
Spelldata
  • id:111898
  • name:Grimoire: Felguard
  • school:shadow
  • tooltip:
  • description:Summons a Felguard who attacks the target for {$s1=15} sec that deals {$216187s1=25}% increased damage. This Felguard will stun their target when summoned.
 
Nether Portal 2.0 183.56sec

Stats details: nether_portal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.0911 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: nether_portal

Static Values
  • id:267217
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Spelldata
  • id:267217
  • name:Nether Portal
  • school:shadow
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Summon Demonic Tyrant 3.6 93.73sec

Stats details: summon_demonic_tyrant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.59 0.00 0.00 0.00 1.5107 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_demonic_tyrant

Static Values
  • id:265187
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
Spelldata
  • id:265187
  • name:Summon Demonic Tyrant
  • school:shadow
  • tooltip:
  • description:Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.
 
Summon Felguard 1.0 0.00sec

Stats details: summon_felguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_felguard

Static Values
  • id:30146
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:30146
  • name:Summon Felguard
  • school:shadow
  • tooltip:
  • description:Summons a Felguard under your command as a powerful melee combatant.
 
summon_random_demon 15.2 13.88sec

Stats details: summon_random_demon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.20 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_random_demon

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
 
Summon Vilefiend 6.7 47.39sec

Stats details: summon_vilefiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.74 0.00 0.00 0.00 1.5412 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_vilefiend

Static Values
  • id:264119
  • school:fire
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Spelldata
  • id:264119
  • name:Summon Vilefiend
  • school:fire
  • tooltip:
  • description:Summon a Vilefiend to fight for you for the next {$d=15 seconds}.
 
pet - grimoire_felguard
Axe Toss 4.0 80.02sec

Stats details: axe_toss

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: axe_toss

Static Values
  • id:89766
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89766
  • name:Axe Toss
  • school:physical
  • tooltip:Stunned for {$d=4 seconds}.
  • description:The $?s108499[Wrathguard][Felguard] hurls its weapon, stunning the target for {$89766d=4 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:28.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=7}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 101.1sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 187.7sec 187.7sec 6.76% 8.33% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Demonic Calling 12.7 14.9 23.4sec 10.4sec 51.16% 83.05% 14.9(14.9) 0.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_calling_1:51.16%

Trigger Attempt Success

  • trigger_pct:20.04%

Spelldata details

  • id:205146
  • name:Demonic Calling
  • tooltip:Your next Call Dreadstalkers costs {$205145s1=1} less Soul Shard and has no cast time.
  • description:{$@spelldesc205145=Shadow Bolt{$?s264178=true}[ and Demonbolt have][ has] a {$h=20}% chance to make your next Call Dreadstalkers cost {$s1=1} less Soul Shard and have no cast time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Demonic Core 22.6 30.2 12.7sec 5.3sec 39.72% 100.00% 4.5(4.5) 0.4

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_demonic_core
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_core_1:16.02%
  • demonic_core_2:16.23%
  • demonic_core_3:5.18%
  • demonic_core_4:2.29%

Trigger Attempt Success

  • trigger_pct:25.99%

Spelldata details

  • id:264173
  • name:Demonic Core
  • tooltip:The cast time of Demonbolt is reduced by {$s1=100}%.
  • description:{$@spelldesc267102=When your Wild Imps expend all of their energy or are imploded, you have a {$s1=10}% chance to absorb their life essence, granting you a stack of Demonic Core. When your summoned Dreadstalkers fade away, you have a {$s2=100}% chance to absorb their life essence, granting you a stack of Demonic Core. Demonic Core reduces the cast time of Demonbolt by {$264173s1=100}%. Maximum {$264173u=4} stacks.}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Demonic Power 3.6 0.0 93.7sec 93.7sec 17.62% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_demonic_power
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_power_1:17.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:265273
  • name:Demonic Power
  • tooltip:Damage dealt by your demons increased by {$s2=15}%.
  • description:{$@spelldesc265187=Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
dreadstalkers 11.5 17.6 26.8sec 10.1sec 66.01% 0.00% 0.0(0.0) 10.8

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_dreadstalkers
  • max_stacks:4
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • dreadstalkers_2:59.48%
  • dreadstalkers_4:6.53%

Trigger Attempt Success

  • trigger_pct:100.00%
eyes_of_guldan 0.1 0.4 182.6sec 1.6sec 1.21% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_eyes_of_guldan
  • max_stacks:4
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • eyes_of_guldan_4:1.22%

Trigger Attempt Success

  • trigger_pct:100.00%
grimoire_felguard 3.0 0.0 120.8sec 120.8sec 19.70% 0.00% 0.0(0.0) 2.8

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_grimoire_felguard
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • grimoire_felguard_1:19.70%

Trigger Attempt Success

  • trigger_pct:100.00%
Ignition Mage's Fuse 2.4 0.0 172.0sec 172.0sec 14.82% 0.00% 2.0(2.0) 2.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:275.80

Stack Uptimes

  • ignition_mages_fuse_1:3.12%
  • ignition_mages_fuse_2:3.08%
  • ignition_mages_fuse_3:3.04%
  • ignition_mages_fuse_4:2.88%
  • ignition_mages_fuse_5:2.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Nether Portal 2.0 0.0 183.5sec 183.5sec 10.14% 18.62% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_nether_portal
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • nether_portal_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267217
  • name:Nether Portal
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Overwhelming Power 4.3 2.9 67.4sec 36.9sec 43.80% 0.00% 2.9(40.4) 0.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • overwhelming_power_1:1.29%
  • overwhelming_power_2:1.32%
  • overwhelming_power_3:1.36%
  • overwhelming_power_4:1.39%
  • overwhelming_power_5:1.42%
  • overwhelming_power_6:1.46%
  • overwhelming_power_7:1.50%
  • overwhelming_power_8:1.54%
  • overwhelming_power_9:1.58%
  • overwhelming_power_10:1.63%
  • overwhelming_power_11:1.67%
  • overwhelming_power_12:1.71%
  • overwhelming_power_13:1.76%
  • overwhelming_power_14:1.81%
  • overwhelming_power_15:1.86%
  • overwhelming_power_16:1.91%
  • overwhelming_power_17:1.97%
  • overwhelming_power_18:2.02%
  • overwhelming_power_19:2.08%
  • overwhelming_power_20:2.14%
  • overwhelming_power_21:2.20%
  • overwhelming_power_22:2.26%
  • overwhelming_power_23:2.33%
  • overwhelming_power_24:2.38%
  • overwhelming_power_25:1.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
portal_summons 2.0 13.2 183.5sec 13.9sec 19.56% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_portal_summons
  • max_stacks:40
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • portal_summons_1:1.92%
  • portal_summons_2:0.77%
  • portal_summons_3:1.24%
  • portal_summons_4:1.88%
  • portal_summons_5:1.45%
  • portal_summons_6:1.81%
  • portal_summons_7:4.26%
  • portal_summons_8:5.87%
  • portal_summons_9:0.36%

Trigger Attempt Success

  • trigger_pct:100.00%
prince_malchezaar 0.1 0.0 184.4sec 91.0sec 1.20% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_prince_malchezaar
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • prince_malchezaar_1:1.20%

Trigger Attempt Success

  • trigger_pct:100.00%
Quick Navigation 6.0 22.4 52.3sec 10.3sec 67.51% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:17.71%
  • quick_navigation_2:17.05%
  • quick_navigation_3:16.67%
  • quick_navigation_4:16.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.3 0.0 52.3sec 52.3sec 17.50% 0.00% 0.0(0.0) 5.2

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:17.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Supreme Commander 4.3 0.1 82.6sec 79.9sec 17.01% 0.00% 0.1(0.1) 3.3

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_supreme_commander
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:838.00

Stack Uptimes

  • supreme_commander_1:17.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279878
  • name:Supreme Commander
  • tooltip:
  • description:When your Demonic Tyrant expires, consume its life essence, granting you a stack of Demonic Core and increasing your Intellect by {$s1=398} for {$279885d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tyrant 3.6 0.0 93.7sec 93.7sec 17.62% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_tyrant
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • tyrant_1:17.62%

Trigger Attempt Success

  • trigger_pct:100.00%
vilefiend 6.7 0.0 47.4sec 47.4sec 47.72% 0.00% 0.0(0.0) 6.3

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_vilefiend
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vilefiend_1:47.72%

Trigger Attempt Success

  • trigger_pct:100.00%
wild_imps 5.4 149.4 55.1sec 0.0sec 95.25% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_wild_imps
  • max_stacks:40
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • wild_imps_1:2.32%
  • wild_imps_2:2.79%
  • wild_imps_3:29.93%
  • wild_imps_4:7.73%
  • wild_imps_5:9.39%
  • wild_imps_6:24.61%
  • wild_imps_7:5.39%
  • wild_imps_8:3.72%
  • wild_imps_9:4.88%
  • wild_imps_10:1.49%
  • wild_imps_11:1.19%
  • wild_imps_12:1.19%
  • wild_imps_13:0.45%
  • wild_imps_14:0.13%
  • wild_imps_15:0.04%
  • wild_imps_16:0.01%
  • wild_imps_17:0.00%
felguard: Demonic Strength 5.5 0.0 60.5sec 60.5sec 10.79% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Felguard_felguard
  • cooldown name:buff_demonic_strength
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_strength_1:10.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267171
  • name:Demonic Strength
  • tooltip:Your next Felstorm will deal {$s2=400}% increased damage.
  • description:Infuse your Felguard with demonic strength and command it to charge your target and unleash a Felstorm that will deal {$s2=400}% increased damage.
  • max_stacks:0
  • duration:20.00
  • cooldown:60.00
  • default_chance:0.00%
grimoire_felguard: Grimoire of Service 3.0 0.0 120.8sec 120.8sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Felguard_grimoire_felguard
  • cooldown name:buff_grimoire_of_service
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • grimoire_of_service_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216187
  • name:Grimoire of Service
  • tooltip:Summoned by a Grimoire of Service. Damage done increased by {$s1=25}%.
  • description:{$@spelldesc108501=Summons a second demon which fights for you for {$s1=25} sec and deals {$216187s1=25}% increased damage. 1.5 min cooldown. The demon will immmediately use one of its special abilities when summoned: $@spellname111859: Cleanses 1 harmful Magic effect from you. $@spellname111895 Taunts its target. $@spellname111896 Seduces its target. $@spellname111897 Interrupts its target.$?c2[ $@spellname111898 Stuns its target.][]}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
summon_random_demon 15.2 13.9sec
one_shard_hog 9.2 22.0sec
two_shard_hog 3.6 17.7sec
three_shard_hog 46.4 6.0sec
portal_summon 15.2 13.9sec

Resources

Resource Usage Type Count Total Average RPE APR
DStr_GF_Felguard
call_dreadstalkers Soul Shard 14.5 17.0 1.2 1.2 0.0
demonbolt Mana 44.4 88858.3 2000.0 2045.9 4.2
grimoire_felguard Soul Shard 3.0 3.0 1.0 1.0 0.0
hand_of_guldan Soul Shard 59.2 155.6 2.6 2.6 1973.1
shadow_bolt Mana 93.0 186084.7 2000.0 2000.1 2.1
summon_demonic_tyrant Mana 3.6 7183.7 2000.0 2000.2 0.0
summon_vilefiend Soul Shard 6.7 6.7 1.0 1.0 0.0
pet - felguard
demonic_strength_felstorm Energy 5.4 325.6 60.0 60.0 729.7
felstorm Energy 10.2 609.9 60.0 60.0 180.5
legion_strike Energy 53.2 3192.5 60.0 60.0 91.2
pet - grimoire_felguard
felstorm Energy 3.9 235.9 60.0 60.0 192.8
legion_strike Energy 18.4 1104.7 60.0 60.0 116.6
pet - wild_imp
fel_firebolt Energy 977.2 15182.3 15.5 15.5 48.1
Resource Gains Type Count Total Average Overflow
demonbolt Soul Shard 44.43 88.83 (48.84%) 2.00 0.03 0.04%
shadow_bolt Soul Shard 93.04 93.04 (51.16%) 1.00 0.00 0.00%
mana_regen Mana 551.45 279632.31 (100.00%) 507.08 19806.13 6.61%
pet - felguard
energy_regen Energy 378.67 3988.03 (100.00%) 10.53 18.58 0.46%
pet - grimoire_felguard
energy_regen Energy 91.46 913.31 (100.00%) 9.99 48.34 5.03%
pet - demonic_tyrant
energy_regen Energy 37.64 0.00 (0.00%) 0.00 759.81 100.00%
pet - bilescourge
energy_regen Energy 11.48 0.00 (0.00%) 0.00 158.28 100.00%
pet - bilescourge
energy_regen Energy 11.20 0.00 (0.00%) 0.00 155.02 100.00%
pet - bilescourge
energy_regen Energy 9.07 0.00 (0.00%) 0.00 125.95 100.00%
pet - bilescourge
energy_regen Energy 12.35 0.00 (0.00%) 0.00 171.14 100.00%
pet - bilescourge
energy_regen Energy 6.76 0.00 (0.00%) 0.00 93.38 100.00%
Resource RPS-Gain RPS-Loss
Mana 932.14 940.46
Soul Shard 0.61 0.61
Combat End Resource Mean Min Max
Mana 97533.44 93340.00 100000.00
Soul Shard 2.56 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 4.1%

Statistics & Data Analysis

Fight Length
Sample Data DStr_GF_Felguard Fight Length
Count 4999
Mean 299.99
Minimum 240.01
Maximum 359.96
Spread ( max - min ) 119.95
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data DStr_GF_Felguard Damage Per Second
Count 4999
Mean 16975.13
Minimum 15191.95
Maximum 19279.77
Spread ( max - min ) 4087.82
Range [ ( max - min ) / 2 * 100% ] 12.04%
Standard Deviation 568.9279
5th Percentile 16125.00
95th Percentile 17979.31
( 95th Percentile - 5th Percentile ) 1854.32
Mean Distribution
Standard Deviation 8.0467
95.00% Confidence Intervall ( 16959.36 - 16990.90 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4316
0.1 Scale Factor Error with Delta=300 2764
0.05 Scale Factor Error with Delta=300 11053
0.01 Scale Factor Error with Delta=300 276311
Priority Target DPS
Sample Data DStr_GF_Felguard Priority Target Damage Per Second
Count 4999
Mean 16975.13
Minimum 15191.95
Maximum 19279.77
Spread ( max - min ) 4087.82
Range [ ( max - min ) / 2 * 100% ] 12.04%
Standard Deviation 568.9279
5th Percentile 16125.00
95th Percentile 17979.31
( 95th Percentile - 5th Percentile ) 1854.32
Mean Distribution
Standard Deviation 8.0467
95.00% Confidence Intervall ( 16959.36 - 16990.90 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4316
0.1 Scale Factor Error with Delta=300 2764
0.05 Scale Factor Error with Delta=300 11053
0.01 Scale Factor Error with Delta=300 276311
DPS(e)
Sample Data DStr_GF_Felguard Damage Per Second (Effective)
Count 4999
Mean 16975.13
Minimum 15191.95
Maximum 19279.77
Spread ( max - min ) 4087.82
Range [ ( max - min ) / 2 * 100% ] 12.04%
Damage
Sample Data DStr_GF_Felguard Damage
Count 4999
Mean 1214528.24
Minimum 868853.30
Maximum 1592380.30
Spread ( max - min ) 723527.00
Range [ ( max - min ) / 2 * 100% ] 29.79%
DTPS
Sample Data DStr_GF_Felguard Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data DStr_GF_Felguard Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data DStr_GF_Felguard Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data DStr_GF_Felguard Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data DStr_GF_Felguard Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data DStr_GF_Felguard Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data DStr_GF_FelguardTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data DStr_GF_Felguard Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 inner_demons,if=talent.inner_demons.enabled
5 0.00 snapshot_stats
6 0.00 potion
7 0.00 demonbolt
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,if=pet.demonic_tyrant.active|target.time_to_die<30
9 2.37 use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
A 2.00 berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
B 5.47 demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
C 0.00 call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
D 0.00 call_action_list,name=implosion,if=spell_targets.implosion>1
E 1.97 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
F 4.77 summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
G 11.55 call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
H 1.61 summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
0.00 doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
I 43.19 hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
0.00 soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
J 39.82 demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
0.00 bilescourge_bombers
K 0.00 call_action_list,name=build_a_shard
actions.build_a_shard
# count action,conditions
0.00 demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
0.00 soul_strike
L 93.54 shadow_bolt
actions.nether_portal_active
# count action,conditions
P 1.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
Q 2.00 summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
R 2.00 call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
S 0.00 call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
T 13.90 hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
U 1.97 summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
V 0.02 summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
W 3.61 demonbolt,if=buff.demonic_core.up
X 0.00 call_action_list,name=build_a_shard
actions.nether_portal_building
# count action,conditions
Y 2.00 nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Z 1.01 call_dreadstalkers
a 0.54 hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
b 1.80 hand_of_guldan,if=soul_shard>=5
c 0.00 call_action_list,name=build_a_shard

Sample Sequence

012367BYPQRTU9ALTLTLTLTLTLTLLLLLIGJLIJLIJJILLIJJIJILLLGLFLILLLIBJJLILGJILLILLLIJLLLGIJIJJFH8ILLLLLGILLIJJIBEJJIJLLGILLILLLFJIJLLGILLILLLLLbLLLZaLLLBLLYTTWTU9AWQLRTLTLTLTLLLIJJIJLLGIJILLLILJIJLLLGLFBEIJLIJJILLLGILLLILLLILJJILGLIHJLFLILLLLLG

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask DStr_GF_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food DStr_GF_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 augmentation DStr_GF_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_felguard Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 potion Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard battle_potion_of_intellect
0:00.000 precombat 7 demonbolt Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard battle_potion_of_intellect
0:00.000 default B demonic_strength Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard archive_of_the_titans, battle_potion_of_intellect
0:01.277 nether_portal_building Y nether_portal Fluffy_Pillow 99277.0/100000: 99% mana | 5.0/5: 100% soul_shard bloodlust, archive_of_the_titans, battle_potion_of_intellect
0:02.260 nether_portal_active P grimoire_felguard Fluffy_Pillow 100000.0/100000: 100% mana | 5.0/5: 100% soul_shard bloodlust, nether_portal, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:03.243 nether_portal_active Q summon_vilefiend Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, nether_portal, grimoire_felguard, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:04.551 nether_portal_active R call_dreadstalkers Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, nether_portal, vilefiend, grimoire_felguard, portal_summons(2), archive_of_the_titans, battle_potion_of_intellect
0:05.859 nether_portal_active T hand_of_guldan Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(3), archive_of_the_titans(2), battle_potion_of_intellect
0:06.843 nether_portal_active U summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(4), archive_of_the_titans(2), battle_potion_of_intellect
0:08.151 default 9 use_items Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), archive_of_the_titans(2), battle_potion_of_intellect
0:08.151 default A berserking Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.151 build_a_shard L shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.252 nether_portal_active T hand_of_guldan Fluffy_Pillow 97105.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:10.079 build_a_shard L shadow_bolt Fluffy_Pillow 97932.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(5), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:11.181 nether_portal_active T hand_of_guldan Fluffy_Pillow 97034.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(5), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:12.009 build_a_shard L shadow_bolt Fluffy_Pillow 97862.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(6), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:13.109 nether_portal_active T hand_of_guldan Fluffy_Pillow 96962.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(6), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.910 build_a_shard L shadow_bolt Fluffy_Pillow 97763.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(7), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.974 nether_portal_active T hand_of_guldan Fluffy_Pillow 96827.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(7), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.775 build_a_shard L shadow_bolt Fluffy_Pillow 97628.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.839 nether_portal_active T hand_of_guldan Fluffy_Pillow 96692.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.613 build_a_shard L shadow_bolt Fluffy_Pillow 97466.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.645 nether_portal_active T hand_of_guldan Fluffy_Pillow 96498.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.535 build_a_shard L shadow_bolt Fluffy_Pillow 97388.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:20.723 build_a_shard L shadow_bolt Fluffy_Pillow 96576.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.874 build_a_shard L shadow_bolt Fluffy_Pillow 95727.0/100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:23.027 build_a_shard L shadow_bolt Fluffy_Pillow 94880.0/100000: 95% mana | 3.0/5: 60% soul_shard bloodlust, demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation, archive_of_the_titans(5), ignition_mages_fuse(4)
0:24.173 build_a_shard L shadow_bolt Fluffy_Pillow 94026.0/100000: 94% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation, archive_of_the_titans(5), ignition_mages_fuse(5)
0:25.283 default I hand_of_guldan Fluffy_Pillow 93136.0/100000: 93% mana | 5.0/5: 100% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation, archive_of_the_titans(6), ignition_mages_fuse(5)
0:26.115 default G call_dreadstalkers Fluffy_Pillow 93968.0/100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation, archive_of_the_titans(6), ignition_mages_fuse(5)
0:27.228 default J demonbolt Fluffy_Pillow 95081.0/100000: 95% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(8), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation, archive_of_the_titans(6), ignition_mages_fuse(5)
0:28.063 build_a_shard L shadow_bolt Fluffy_Pillow 93916.0/100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, supreme_commander, wild_imps(7), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation, archive_of_the_titans(6), ignition_mages_fuse(5)
0:29.174 default I hand_of_guldan Fluffy_Pillow 93027.0/100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(3), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation, overwhelming_power(25), archive_of_the_titans(6)
0:30.019 default J demonbolt Fluffy_Pillow 93872.0/100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(3), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation, overwhelming_power(24), archive_of_the_titans(7)
0:30.871 build_a_shard L shadow_bolt Fluffy_Pillow 92724.0/100000: 93% mana | 2.0/5: 40% soul_shard bloodlust, supreme_commander, wild_imps(3), dreadstalkers(4), vilefiend, grimoire_felguard, quick_navigation, overwhelming_power(24), archive_of_the_titans(7)
0:32.003 default I hand_of_guldan Fluffy_Pillow 91856.0/100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, supreme_commander, wild_imps(6), dreadstalkers(4), vilefiend, grimoire_felguard, quick_navigation, overwhelming_power(22), archive_of_the_titans(7)
0:32.864 default J demonbolt Fluffy_Pillow 92717.0/100000: 93% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(2), supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(22), archive_of_the_titans(7)
0:33.724 default J demonbolt Fluffy_Pillow 91577.0/100000: 92% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(21), archive_of_the_titans(7)
0:34.590 default I hand_of_guldan Fluffy_Pillow 90443.0/100000: 90% mana | 4.0/5: 80% soul_shard bloodlust, supreme_commander, wild_imps(5), dreadstalkers(2), quick_navigation, overwhelming_power(20), archive_of_the_titans(7)
0:35.460 build_a_shard L shadow_bolt Fluffy_Pillow 91313.0/100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation(2), overwhelming_power(19), archive_of_the_titans(8)
0:36.621 build_a_shard L shadow_bolt Fluffy_Pillow 90474.0/100000: 90% mana | 2.0/5: 40% soul_shard bloodlust, supreme_commander, wild_imps(7), dreadstalkers(2), quick_navigation(2), overwhelming_power(18), archive_of_the_titans(8)
0:37.787 default I hand_of_guldan Fluffy_Pillow 89640.0/100000: 90% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation(2), overwhelming_power(17), archive_of_the_titans(8)
0:38.666 default J demonbolt Fluffy_Pillow 90519.0/100000: 91% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core, wild_imps(6), dreadstalkers(2), quick_navigation(2), overwhelming_power(16), archive_of_the_titans(8)
0:39.551 default J demonbolt Fluffy_Pillow 89404.0/100000: 89% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core(2), wild_imps(6), quick_navigation(2), overwhelming_power(15), archive_of_the_titans(8)
0:40.440 default I hand_of_guldan Fluffy_Pillow 88293.0/100000: 88% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, wild_imps(6), quick_navigation(2), overwhelming_power(24), archive_of_the_titans(9)
0:41.285 default J demonbolt Fluffy_Pillow 89138.0/100000: 89% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(6), quick_navigation(2), overwhelming_power(23), archive_of_the_titans(9)
0:42.390 default I hand_of_guldan Fluffy_Pillow 88243.0/100000: 88% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), quick_navigation(2), overwhelming_power(22), archive_of_the_titans(9)
0:43.500 build_a_shard L shadow_bolt Fluffy_Pillow 89353.0/100000: 89% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(6), quick_navigation(2), overwhelming_power(21), archive_of_the_titans(9)
0:44.987 build_a_shard L shadow_bolt Fluffy_Pillow 88840.0/100000: 89% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(7), quick_navigation(2), overwhelming_power(20), archive_of_the_titans(9)
0:46.484 build_a_shard L shadow_bolt Fluffy_Pillow 88337.0/100000: 88% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(8), quick_navigation(2), overwhelming_power(18), archive_of_the_titans(10)
0:47.996 default G call_dreadstalkers Fluffy_Pillow 87849.0/100000: 88% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), quick_navigation(3), overwhelming_power(17), archive_of_the_titans(10)
0:49.132 build_a_shard L shadow_bolt Fluffy_Pillow 88985.0/100000: 89% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(3), overwhelming_power(15), archive_of_the_titans(10)
0:50.661 default F summon_vilefiend Fluffy_Pillow 88514.0/100000: 89% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(3), overwhelming_power(14), archive_of_the_titans(11)
0:52.198 build_a_shard L shadow_bolt Fluffy_Pillow 90051.0/100000: 90% mana | 2.0/5: 40% soul_shard wild_imps(2), dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power(12), archive_of_the_titans(11)
0:53.753 default I hand_of_guldan Fluffy_Pillow 89606.0/100000: 90% mana | 3.0/5: 60% soul_shard dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power(11), archive_of_the_titans(11)
0:54.927 build_a_shard L shadow_bolt Fluffy_Pillow 90780.0/100000: 91% mana | 0.0/5: 0% soul_shard dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power(10), archive_of_the_titans(11)
0:56.500 build_a_shard L shadow_bolt Fluffy_Pillow 90353.0/100000: 90% mana | 1.0/5: 20% soul_shard wild_imps(2), dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power(8), archive_of_the_titans(12)
0:58.092 build_a_shard L shadow_bolt Fluffy_Pillow 89945.0/100000: 90% mana | 2.0/5: 40% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power(6), archive_of_the_titans(12)
0:59.704 default I hand_of_guldan Fluffy_Pillow 89557.0/100000: 90% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power(5), archive_of_the_titans(12)
1:00.920 default B demonic_strength Fluffy_Pillow 90773.0/100000: 91% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(3), vilefiend, quick_navigation(3), overwhelming_power(4), archive_of_the_titans(13)
1:02.142 default J demonbolt Fluffy_Pillow 91995.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(4), vilefiend, quick_navigation(3), overwhelming_power(2), archive_of_the_titans(13)
1:03.379 default J demonbolt Fluffy_Pillow 91232.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(6), vilefiend, quick_navigation(3), overwhelming_power, archive_of_the_titans(13)
1:04.624 build_a_shard L shadow_bolt Fluffy_Pillow 90477.0/100000: 90% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(4), vilefiend, quick_navigation(3), archive_of_the_titans(13)
1:06.293 default I hand_of_guldan Fluffy_Pillow 90146.0/100000: 90% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(3), vilefiend, quick_navigation(3), archive_of_the_titans(14)
1:07.546 build_a_shard L shadow_bolt Fluffy_Pillow 91399.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(3), quick_navigation(3), archive_of_the_titans(14)
1:09.215 default G call_dreadstalkers Fluffy_Pillow 91068.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(5), quick_navigation(3), archive_of_the_titans(14)
1:10.467 default J demonbolt Fluffy_Pillow 92320.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(5), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(15)
1:11.719 default I hand_of_guldan Fluffy_Pillow 91572.0/100000: 92% mana | 4.0/5: 80% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(15)
1:12.971 build_a_shard L shadow_bolt Fluffy_Pillow 92824.0/100000: 93% mana | 1.0/5: 20% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(15)
1:14.630 build_a_shard L shadow_bolt Fluffy_Pillow 92483.0/100000: 92% mana | 2.0/5: 40% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(15)
1:16.288 default I hand_of_guldan Fluffy_Pillow 92141.0/100000: 92% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(16)
1:17.474 build_a_shard L shadow_bolt Fluffy_Pillow 93327.0/100000: 93% mana | 0.0/5: 0% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(16)
1:19.056 build_a_shard L shadow_bolt Fluffy_Pillow 92909.0/100000: 93% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(16)
1:20.639 build_a_shard L shadow_bolt Fluffy_Pillow 92492.0/100000: 92% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(17)
1:22.220 default I hand_of_guldan Fluffy_Pillow 92073.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(5), quick_navigation_final, archive_of_the_titans(17)
1:23.407 default J demonbolt Fluffy_Pillow 93260.0/100000: 93% mana | 0.0/5: 0% soul_shard demonic_core(3), wild_imps(3), quick_navigation_final, archive_of_the_titans(17)
1:24.594 build_a_shard L shadow_bolt Fluffy_Pillow 92447.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation_final, archive_of_the_titans(17)
1:26.174 build_a_shard L shadow_bolt Fluffy_Pillow 92027.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation_final, archive_of_the_titans(18)
1:27.757 build_a_shard L shadow_bolt Fluffy_Pillow 91610.0/100000: 92% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), archive_of_the_titans(18)
1:29.457 default G call_dreadstalkers Fluffy_Pillow 91310.0/100000: 91% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), archive_of_the_titans(18)
1:30.733 default I hand_of_guldan Fluffy_Pillow 92586.0/100000: 93% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), archive_of_the_titans(19)
1:32.011 default J demonbolt Fluffy_Pillow 93864.0/100000: 94% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), archive_of_the_titans(19)
1:33.289 default I hand_of_guldan Fluffy_Pillow 93142.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(2), dreadstalkers(2), archive_of_the_titans(19)
1:34.567 default J demonbolt Fluffy_Pillow 94420.0/100000: 94% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation, archive_of_the_titans(19)
1:35.835 default J demonbolt Fluffy_Pillow 93688.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
1:37.102 default F summon_vilefiend Fluffy_Pillow 92955.0/100000: 93% mana | 4.0/5: 80% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
1:38.873 default H summon_demonic_tyrant Fluffy_Pillow 94726.0/100000: 95% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
1:40.553 default 8 potion Fluffy_Pillow 94406.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20)
1:40.553 default I hand_of_guldan Fluffy_Pillow 94406.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20), battle_potion_of_intellect
1:41.813 build_a_shard L shadow_bolt Fluffy_Pillow 95666.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20), battle_potion_of_intellect
1:43.492 build_a_shard L shadow_bolt Fluffy_Pillow 95345.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20), battle_potion_of_intellect
1:45.173 build_a_shard L shadow_bolt Fluffy_Pillow 95026.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:46.844 build_a_shard L shadow_bolt Fluffy_Pillow 94697.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:48.513 build_a_shard L shadow_bolt Fluffy_Pillow 94366.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:50.182 default G call_dreadstalkers Fluffy_Pillow 94035.0/100000: 94% mana | 5.0/5: 100% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:51.436 default I hand_of_guldan Fluffy_Pillow 95289.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_power, wild_imps(7), dreadstalkers(4), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:52.689 build_a_shard L shadow_bolt Fluffy_Pillow 96542.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(7), dreadstalkers(4), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:54.358 build_a_shard L shadow_bolt Fluffy_Pillow 96211.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(9), dreadstalkers(4), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:56.028 default I hand_of_guldan Fluffy_Pillow 95881.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core, supreme_commander, wild_imps(10), dreadstalkers(4), vilefiend, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:57.280 default J demonbolt Fluffy_Pillow 97133.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core(3), supreme_commander, wild_imps(10), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:58.525 default J demonbolt Fluffy_Pillow 96378.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core(2), supreme_commander, wild_imps(10), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:59.770 default I hand_of_guldan Fluffy_Pillow 95623.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core, supreme_commander, wild_imps(10), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:01.016 default B demonic_strength Fluffy_Pillow 96869.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core, supreme_commander, wild_imps(9), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
2:02.203 default E grimoire_felguard Fluffy_Pillow 98056.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(3), supreme_commander, wild_imps(10), vilefiend, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
2:03.448 default J demonbolt Fluffy_Pillow 99301.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core(3), supreme_commander, wild_imps(8), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
2:04.636 default J demonbolt Fluffy_Pillow 98489.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
2:05.826 default I hand_of_guldan Fluffy_Pillow 97679.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
2:07.015 default J demonbolt Fluffy_Pillow 98868.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(4), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
2:08.201 build_a_shard L shadow_bolt Fluffy_Pillow 98054.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_calling, supreme_commander, wild_imps(4), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
2:09.784 build_a_shard L shadow_bolt Fluffy_Pillow 97637.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_calling, supreme_commander, wild_imps(6), grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
2:11.365 default G call_dreadstalkers Fluffy_Pillow 97218.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(3), grimoire_felguard, archive_of_the_titans(20)
2:12.642 default I hand_of_guldan Fluffy_Pillow 98495.0/100000: 98% mana | 4.0/5: 80% soul_shard wild_imps(3), dreadstalkers(2), grimoire_felguard, archive_of_the_titans(20)
2:13.918 build_a_shard L shadow_bolt Fluffy_Pillow 99771.0/100000: 100% mana | 1.0/5: 20% soul_shard wild_imps(3), dreadstalkers(2), grimoire_felguard, archive_of_the_titans(20)
2:15.618 build_a_shard L shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(5), dreadstalkers(2), grimoire_felguard, quick_navigation, archive_of_the_titans(20)
2:17.308 default I hand_of_guldan Fluffy_Pillow 97694.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
2:18.575 build_a_shard L shadow_bolt Fluffy_Pillow 98961.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
2:20.264 build_a_shard L shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
2:21.954 build_a_shard L shadow_bolt Fluffy_Pillow 97694.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:23.634 default F summon_vilefiend Fluffy_Pillow 97374.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation(2), archive_of_the_titans(20)
2:25.549 default J demonbolt Fluffy_Pillow 99289.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(3), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:26.808 default I hand_of_guldan Fluffy_Pillow 98548.0/100000: 99% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(3), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:28.068 default J demonbolt Fluffy_Pillow 99808.0/100000: 100% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:29.320 build_a_shard L shadow_bolt Fluffy_Pillow 99060.0/100000: 99% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps, vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:30.987 build_a_shard L shadow_bolt Fluffy_Pillow 98002.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(3), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:32.657 default G call_dreadstalkers Fluffy_Pillow 97672.0/100000: 98% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(3), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:33.907 default I hand_of_guldan Fluffy_Pillow 98922.0/100000: 99% mana | 4.0/5: 80% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:35.159 build_a_shard L shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
2:36.820 build_a_shard L shadow_bolt Fluffy_Pillow 98006.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
2:38.402 default I hand_of_guldan Fluffy_Pillow 97588.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
2:39.591 build_a_shard L shadow_bolt Fluffy_Pillow 98777.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
2:41.173 build_a_shard L shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:42.756 build_a_shard L shadow_bolt Fluffy_Pillow 97587.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:44.339 build_a_shard L shadow_bolt Fluffy_Pillow 97170.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:45.921 build_a_shard L shadow_bolt Fluffy_Pillow 96752.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(3), quick_navigation_final, archive_of_the_titans(20)
2:47.504 nether_portal_building b hand_of_guldan Fluffy_Pillow 96335.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_core(2), wild_imps(3), archive_of_the_titans(20)
2:48.781 build_a_shard L shadow_bolt Fluffy_Pillow 97612.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(2), archive_of_the_titans(20)
2:50.480 build_a_shard L shadow_bolt Fluffy_Pillow 97311.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(2), archive_of_the_titans(20)
2:52.183 build_a_shard L shadow_bolt Fluffy_Pillow 97014.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(3), archive_of_the_titans(20)
2:53.882 nether_portal_building Z call_dreadstalkers Fluffy_Pillow 96713.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(2), wild_imps(3), quick_navigation, archive_of_the_titans(20)
2:55.571 nether_portal_building a hand_of_guldan Fluffy_Pillow 98402.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation(2), overwhelming_power(25), archive_of_the_titans(20)
2:56.663 build_a_shard L shadow_bolt Fluffy_Pillow 99494.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation(2), overwhelming_power(24), archive_of_the_titans(20)
2:58.127 build_a_shard L shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(4), dreadstalkers(2), quick_navigation(3), overwhelming_power(22), archive_of_the_titans(20)
2:59.600 build_a_shard L shadow_bolt Fluffy_Pillow 97478.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(3), overwhelming_power(21), archive_of_the_titans(20)
3:01.079 default B demonic_strength Fluffy_Pillow 96957.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(3), overwhelming_power(19), archive_of_the_titans(20)
3:02.200 build_a_shard L shadow_bolt Fluffy_Pillow 98078.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(3), overwhelming_power(18), archive_of_the_titans(20)
3:03.704 build_a_shard L shadow_bolt Fluffy_Pillow 97582.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(3), overwhelming_power(17), archive_of_the_titans(20)
3:05.216 nether_portal_building Y nether_portal Fluffy_Pillow 97094.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(2), dreadstalkers(2), quick_navigation(3), overwhelming_power(15), archive_of_the_titans(20)
3:06.364 nether_portal_active T hand_of_guldan Fluffy_Pillow 98242.0/100000: 98% mana | 5.0/5: 100% soul_shard demonic_calling, nether_portal, dreadstalkers(2), portal_summons, quick_navigation(3), overwhelming_power(14), archive_of_the_titans(20)
3:07.516 nether_portal_active T hand_of_guldan Fluffy_Pillow 99394.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_calling, nether_portal, dreadstalkers(2), portal_summons(2), quick_navigation(3), overwhelming_power(13), archive_of_the_titans(20)
3:08.676 nether_portal_active W demonbolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps, portal_summons(3), quick_navigation(3), overwhelming_power(12), archive_of_the_titans(20)
3:09.844 nether_portal_active T hand_of_guldan Fluffy_Pillow 99168.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, nether_portal, wild_imps(4), portal_summons(3), quick_navigation(3), overwhelming_power(11), archive_of_the_titans(20)
3:11.020 nether_portal_active U summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, nether_portal, wild_imps(5), portal_summons(4), quick_navigation(3), overwhelming_power(9), archive_of_the_titans(20)
3:12.602 default 9 use_items Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, demonic_power, demonic_calling, nether_portal, wild_imps(7), tyrant, portal_summons(4), quick_navigation(3), overwhelming_power(8), archive_of_the_titans(20)
3:12.602 default A berserking Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, demonic_power, demonic_calling, nether_portal, wild_imps(7), tyrant, portal_summons(4), quick_navigation(3), overwhelming_power(8), archive_of_the_titans(20), ignition_mages_fuse
3:12.602 nether_portal_active W demonbolt Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_core, demonic_power, demonic_calling, nether_portal, wild_imps(7), tyrant, portal_summons(4), quick_navigation(3), overwhelming_power(8), archive_of_the_titans(20), ignition_mages_fuse
3:13.609 nether_portal_active Q summon_vilefiend Fluffy_Pillow 97011.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_power, demonic_calling, nether_portal, wild_imps(7), tyrant, portal_summons(4), quick_navigation(3), overwhelming_power(7), archive_of_the_titans(20), ignition_mages_fuse
3:14.959 build_a_shard L shadow_bolt Fluffy_Pillow 98361.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, demonic_calling, nether_portal, wild_imps(7), vilefiend, tyrant, portal_summons(5), quick_navigation(3), overwhelming_power(6), archive_of_the_titans(20), ignition_mages_fuse
3:16.314 nether_portal_active R call_dreadstalkers Fluffy_Pillow 97716.0/100000: 98% mana | 2.0/5: 40% soul_shard berserking, demonic_power, demonic_calling, nether_portal, wild_imps(7), vilefiend, tyrant, portal_summons(5), quick_navigation(4), overwhelming_power(4), archive_of_the_titans(20), ignition_mages_fuse
3:17.338 nether_portal_active T hand_of_guldan Fluffy_Pillow 98740.0/100000: 99% mana | 1.0/5: 20% soul_shard berserking, demonic_power, nether_portal, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation(4), overwhelming_power(3), archive_of_the_titans(20), ignition_mages_fuse(2)
3:18.337 build_a_shard L shadow_bolt Fluffy_Pillow 99739.0/100000: 100% mana | 0.0/5: 0% soul_shard berserking, demonic_power, nether_portal, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), overwhelming_power(2), archive_of_the_titans(20), ignition_mages_fuse(2)
3:19.675 nether_portal_active T hand_of_guldan Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, nether_portal, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), overwhelming_power(25), archive_of_the_titans(20), ignition_mages_fuse(2)
3:20.564 build_a_shard L shadow_bolt Fluffy_Pillow 98894.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), overwhelming_power(24), archive_of_the_titans(20), ignition_mages_fuse(2)
3:21.755 nether_portal_active T hand_of_guldan Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), overwhelming_power(25), archive_of_the_titans(20), ignition_mages_fuse(3)
3:22.621 build_a_shard L shadow_bolt Fluffy_Pillow 98871.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), overwhelming_power(24), archive_of_the_titans(20), ignition_mages_fuse(3)
3:23.951 nether_portal_active T hand_of_guldan Fluffy_Pillow 98003.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation_final, overwhelming_power(23), archive_of_the_titans(20), ignition_mages_fuse(3)
3:24.920 build_a_shard L shadow_bolt Fluffy_Pillow 98972.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation_final, overwhelming_power(22), archive_of_the_titans(20), ignition_mages_fuse(4)
3:26.180 build_a_shard L shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation_final, overwhelming_power(20), archive_of_the_titans(20), ignition_mages_fuse(4)
3:27.452 build_a_shard L shadow_bolt Fluffy_Pillow 97276.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation_final, overwhelming_power(25), archive_of_the_titans(20), ignition_mages_fuse(4)
3:28.695 default I hand_of_guldan Fluffy_Pillow 96519.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(3), supreme_commander, wild_imps(11), vilefiend, portal_summons(7), quick_navigation_final, overwhelming_power(24), archive_of_the_titans(20), ignition_mages_fuse(5)
3:29.612 default J demonbolt Fluffy_Pillow 97436.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core(3), supreme_commander, wild_imps(11), vilefiend, portal_summons(7), quick_navigation_final, overwhelming_power(23), archive_of_the_titans(20), ignition_mages_fuse(5)
3:30.530 default J demonbolt Fluffy_Pillow 96354.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core(2), supreme_commander, wild_imps(10), portal_summons(7), quick_navigation_final, overwhelming_power(22), archive_of_the_titans(20), ignition_mages_fuse(5)
3:31.454 default I hand_of_guldan Fluffy_Pillow 95278.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core, supreme_commander, wild_imps(10), portal_summons(7), quick_navigation_final, overwhelming_power(21), archive_of_the_titans(20), ignition_mages_fuse(5)
3:32.381 default J demonbolt Fluffy_Pillow 96205.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_core, supreme_commander, wild_imps(9), portal_summons(7), quick_navigation_final, overwhelming_power(20), archive_of_the_titans(20), ignition_mages_fuse(5)
3:33.313 build_a_shard L shadow_bolt Fluffy_Pillow 95137.0/100000: 95% mana | 3.0/5: 60% soul_shard supreme_commander, wild_imps(5), portal_summons(7), quick_navigation_final, overwhelming_power(19), archive_of_the_titans(20)
3:34.738 build_a_shard L shadow_bolt Fluffy_Pillow 94562.0/100000: 95% mana | 4.0/5: 80% soul_shard supreme_commander, wild_imps(6), overwhelming_power(18), archive_of_the_titans(20)
3:36.268 default G call_dreadstalkers Fluffy_Pillow 94092.0/100000: 94% mana | 5.0/5: 100% soul_shard demonic_calling, supreme_commander, wild_imps(6), overwhelming_power(16), archive_of_the_titans(20)
3:37.474 default I hand_of_guldan Fluffy_Pillow 95298.0/100000: 95% mana | 4.0/5: 80% soul_shard supreme_commander, wild_imps(6), dreadstalkers(2), overwhelming_power(15), archive_of_the_titans(20)
3:38.641 default J demonbolt Fluffy_Pillow 96465.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_core, supreme_commander, wild_imps(4), dreadstalkers(2), overwhelming_power(14), archive_of_the_titans(20)
3:39.816 default I hand_of_guldan Fluffy_Pillow 95640.0/100000: 96% mana | 3.0/5: 60% soul_shard supreme_commander, wild_imps(4), dreadstalkers(2), overwhelming_power(13), archive_of_the_titans(20)
3:40.999 build_a_shard L shadow_bolt Fluffy_Pillow 96823.0/100000: 97% mana | 0.0/5: 0% soul_shard supreme_commander, wild_imps(6), dreadstalkers(2), overwhelming_power(12), archive_of_the_titans(20)
3:42.582 build_a_shard L shadow_bolt Fluffy_Pillow 96406.0/100000: 96% mana | 1.0/5: 20% soul_shard supreme_commander, wild_imps(5), dreadstalkers(2), overwhelming_power(10), archive_of_the_titans(20)
3:44.183 build_a_shard L shadow_bolt Fluffy_Pillow 96007.0/100000: 96% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), overwhelming_power(8), archive_of_the_titans(20)
3:45.804 default I hand_of_guldan Fluffy_Pillow 95628.0/100000: 96% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), overwhelming_power(7), archive_of_the_titans(20)
3:47.027 build_a_shard L shadow_bolt Fluffy_Pillow 96851.0/100000: 97% mana | 0.0/5: 0% soul_shard wild_imps(6), dreadstalkers(2), overwhelming_power(5), archive_of_the_titans(20)
3:48.675 default J demonbolt Fluffy_Pillow 96499.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(5), overwhelming_power(4), archive_of_the_titans(20)
3:49.919 default I hand_of_guldan Fluffy_Pillow 95743.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(6), overwhelming_power(3), archive_of_the_titans(20)
3:51.170 default J demonbolt Fluffy_Pillow 96994.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(3), overwhelming_power, archive_of_the_titans(20)
3:52.439 build_a_shard L shadow_bolt Fluffy_Pillow 96263.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), archive_of_the_titans(20)
3:54.139 build_a_shard L shadow_bolt Fluffy_Pillow 95963.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), quick_navigation, archive_of_the_titans(20)
3:55.828 build_a_shard L shadow_bolt Fluffy_Pillow 95652.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), quick_navigation(2), archive_of_the_titans(20)
3:57.509 default G call_dreadstalkers Fluffy_Pillow 95333.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(3), quick_navigation(3), archive_of_the_titans(20)
3:58.762 build_a_shard L shadow_bolt Fluffy_Pillow 96586.0/100000: 97% mana | 4.0/5: 80% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
4:00.431 default F summon_vilefiend Fluffy_Pillow 96255.0/100000: 96% mana | 5.0/5: 100% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
4:02.092 default B demonic_strength Fluffy_Pillow 97916.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core, dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
4:03.338 default E grimoire_felguard Fluffy_Pillow 99162.0/100000: 99% mana | 4.0/5: 80% soul_shard demonic_core, dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
4:04.525 default I hand_of_guldan Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard demonic_core, dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
4:05.711 default J demonbolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core, dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
4:06.898 build_a_shard L shadow_bolt Fluffy_Pillow 99187.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps, dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
4:08.480 default I hand_of_guldan Fluffy_Pillow 98004.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
4:09.669 default J demonbolt Fluffy_Pillow 99193.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(3), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
4:10.858 default J demonbolt Fluffy_Pillow 98382.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(4), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
4:12.044 default I hand_of_guldan Fluffy_Pillow 97568.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
4:13.233 build_a_shard L shadow_bolt Fluffy_Pillow 98757.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(6), vilefiend, grimoire_felguard, archive_of_the_titans(20)
4:14.936 build_a_shard L shadow_bolt Fluffy_Pillow 98007.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(7), vilefiend, grimoire_felguard, archive_of_the_titans(20)
4:16.637 build_a_shard L shadow_bolt Fluffy_Pillow 97708.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation, archive_of_the_titans(20)
4:18.327 default G call_dreadstalkers Fluffy_Pillow 97398.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), grimoire_felguard, quick_navigation, archive_of_the_titans(20)
4:19.594 default I hand_of_guldan Fluffy_Pillow 98665.0/100000: 99% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:20.862 build_a_shard L shadow_bolt Fluffy_Pillow 99933.0/100000: 100% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:22.551 build_a_shard L shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation, overwhelming_power(25), archive_of_the_titans(20)
4:24.016 build_a_shard L shadow_bolt Fluffy_Pillow 97469.0/100000: 97% mana | 2.0/5: 40% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation, overwhelming_power(23), archive_of_the_titans(20)
4:25.496 default I hand_of_guldan Fluffy_Pillow 96949.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation, overwhelming_power(22), archive_of_the_titans(20)
4:26.614 build_a_shard L shadow_bolt Fluffy_Pillow 98067.0/100000: 98% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation, overwhelming_power(21), archive_of_the_titans(20)
4:28.109 build_a_shard L shadow_bolt Fluffy_Pillow 97562.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation, overwhelming_power(19), archive_of_the_titans(20)
4:29.622 build_a_shard L shadow_bolt Fluffy_Pillow 97075.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation(2), overwhelming_power(18), archive_of_the_titans(20)
4:31.135 default I hand_of_guldan Fluffy_Pillow 96588.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(2), overwhelming_power(16), archive_of_the_titans(20)
4:32.282 build_a_shard L shadow_bolt Fluffy_Pillow 97735.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(2), overwhelming_power(15), archive_of_the_titans(20)
4:33.818 default J demonbolt Fluffy_Pillow 97271.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation(2), overwhelming_power(14), archive_of_the_titans(20)
4:34.978 default J demonbolt Fluffy_Pillow 96431.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(6), quick_navigation(2), overwhelming_power(13), archive_of_the_titans(20)
4:36.146 default I hand_of_guldan Fluffy_Pillow 95599.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(3), quick_navigation(3), overwhelming_power(11), archive_of_the_titans(20)
4:37.318 build_a_shard L shadow_bolt Fluffy_Pillow 96771.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(3), quick_navigation(3), overwhelming_power(10), archive_of_the_titans(20)
4:38.891 default G call_dreadstalkers Fluffy_Pillow 96344.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(5), quick_navigation(3), overwhelming_power(9), archive_of_the_titans(20)
4:40.077 build_a_shard L shadow_bolt Fluffy_Pillow 97530.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(3), overwhelming_power(7), archive_of_the_titans(20)
4:41.680 default I hand_of_guldan Fluffy_Pillow 97133.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(3), overwhelming_power(6), archive_of_the_titans(20)
4:42.888 default H summon_demonic_tyrant Fluffy_Pillow 98341.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(3), overwhelming_power(5), archive_of_the_titans(20)
4:44.507 default J demonbolt Fluffy_Pillow 97960.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), tyrant, quick_navigation(3), overwhelming_power(3), archive_of_the_titans(20)
4:45.737 build_a_shard L shadow_bolt Fluffy_Pillow 97190.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), tyrant, quick_navigation(3), overwhelming_power(2), archive_of_the_titans(20)
4:47.388 default F summon_vilefiend Fluffy_Pillow 96841.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), tyrant, quick_navigation(3), archive_of_the_titans(20)
4:49.056 build_a_shard L shadow_bolt Fluffy_Pillow 98509.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20)
4:50.725 default I hand_of_guldan Fluffy_Pillow 98004.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), overwhelming_power(25), archive_of_the_titans(20)
4:51.813 build_a_shard L shadow_bolt Fluffy_Pillow 99092.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), overwhelming_power(24), archive_of_the_titans(20)
4:53.268 build_a_shard L shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), overwhelming_power(22), archive_of_the_titans(20)
4:54.739 build_a_shard L shadow_bolt Fluffy_Pillow 97475.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), overwhelming_power(21), archive_of_the_titans(20)
4:56.212 build_a_shard L shadow_bolt Fluffy_Pillow 96948.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), overwhelming_power(19), archive_of_the_titans(20)
4:57.700 build_a_shard L shadow_bolt Fluffy_Pillow 96436.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), overwhelming_power(18), archive_of_the_titans(20)
4:59.196 default G call_dreadstalkers Fluffy_Pillow 95932.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(16), archive_of_the_titans(20)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 9026 8206 7205
Intellect 1467 -3 8475 7287 5476 (377)
Spirit 0 0 0 0 0
Health 180520 164120 0
Mana 100000 100000 0
Soul Shard 5 5 0
Spell Power 8475 7287 0
Crit 17.68% 17.68% 913
Haste 17.90% 17.90% 1217
Damage / Heal Versatility 1.52% 1.52% 129
ManaReg per Second 1000 1000 0
Mastery 26.55% 26.55% 742
Armor 1159 1159 1159
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Horrific Amalgam's Hood
ilevel: 390, stats: { 154 Armor, +655 Int, +1189 Sta }
azerite powers: { Supreme Commander, Overwhelming Power, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Amice of Corrupting Horror
ilevel: 390, stats: { 142 Armor, +491 Int, +892 Sta }
azerite powers: { Archive of the Titans, Heed My Call, Azerite Empowered }
Local Chest Robes of the Unraveler
ilevel: 390, stats: { 189 Armor, +655 Int, +1189 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Azerite Empowered }
Local Waist Cord of Septic Envelopment
ilevel: 385, stats: { 103 Armor, +247 Int, +417 Sta, +115 Haste, +68 Crit }
Local Legs Leggings of Lingering Infestation
ilevel: 385, stats: { 160 Armor, +329 Int, +556 Sta, +133 Haste, +112 Mastery }
Local Feet Volatile Walkers
ilevel: 385, stats: { 126 Armor, +247 Int, +417 Sta, +111 Crit, +72 Vers }
Local Wrists Void-Lashed Wristband
ilevel: 385, stats: { 80 Armor, +185 Int, +312 Sta, +81 Mastery, +57 Vers }
Local Hands Mutagenic Protofluid Handwraps
ilevel: 385, stats: { 114 Armor, +247 Int, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 370, stats: { +271 Int }
Local Trinket2 Vigilant's Bloodshaper
ilevel: 385, stats: { +313 Int }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Tusk of the Reborn Prophet
ilevel: 385, weapon: { 126 - 211, 1.8 }, stats: { +164 Int, +277 Sta, +70 Crit, +51 Haste, +792 Int }, enchant: quick_navigation
Local Off Hand Codex of Imminent Ruin
ilevel: 385, stats: { +277 Sta, +66 Haste, +56 Mastery, +503 Int }

Talents

Level
15 Dreadlash (Demonology Warlock) Demonic Strength (Demonology Warlock) Bilescourge Bombers (Demonology Warlock)
30 Demonic Calling (Demonology Warlock) Power Siphon (Demonology Warlock) Doom (Demonology Warlock)
45 Demon Skin Burning Rush Dark Pact
60 From the Shadows (Demonology Warlock) Soul Strike (Demonology Warlock) Summon Vilefiend (Demonology Warlock)
75 Darkfury Mortal Coil Demonic Circle
90 Soul Conduit (Demonology Warlock) Inner Demons (Demonology Warlock) Grimoire: Felguard (Demonology Warlock)
100 Sacrificed Souls (Demonology Warlock) Demonic Consumption (Demonology Warlock) Nether Portal (Demonology Warlock)

Profile

warlock="DStr_GF_Felguard"
source=default
spec=demonology
level=120
race=troll
role=spell
position=ranged_back
talents=2103033

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/inner_demons,if=talent.inner_demons.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/demonbolt

# Executed every time the actor is available.
actions=potion,if=pet.demonic_tyrant.active|target.time_to_die<30
actions+=/use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
actions+=/demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
actions+=/call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
actions+=/call_action_list,name=implosion,if=spell_targets.implosion>1
actions+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions+=/summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions+=/call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions+=/summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
actions+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
actions+=/doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
actions+=/hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
actions+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
actions+=/bilescourge_bombers
actions+=/call_action_list,name=build_a_shard

actions.build_a_shard=demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
actions.build_a_shard+=/soul_strike
actions.build_a_shard+=/shadow_bolt

actions.implosion=implosion,if=(buff.wild_imps.stack>=6&(soul_shard<3|prev_gcd.1.call_dreadstalkers|buff.wild_imps.stack>=9|prev_gcd.1.bilescourge_bombers|(!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan))&!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan&buff.demonic_power.down)|(time_to_die<3&buff.wild_imps.stack>0)|(prev_gcd.2.call_dreadstalkers&buff.wild_imps.stack>2&!talent.demonic_calling.enabled)
actions.implosion+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.implosion+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.implosion+=/summon_demonic_tyrant
actions.implosion+=/hand_of_guldan,if=soul_shard>=5
actions.implosion+=/hand_of_guldan,if=soul_shard>=3&(((prev_gcd.2.hand_of_guldan|buff.wild_imps.stack>=3)&buff.wild_imps.stack<9)|cooldown.summon_demonic_tyrant.remains<=gcd*2|buff.demonic_power.remains>gcd*2)
actions.implosion+=/demonbolt,if=prev_gcd.1.hand_of_guldan&soul_shard>=1&(buff.wild_imps.stack<=3|prev_gcd.3.hand_of_guldan)&soul_shard<4&buff.demonic_core.up
actions.implosion+=/summon_vilefiend,if=(cooldown.summon_demonic_tyrant.remains>40&spell_targets.implosion<=2)|cooldown.summon_demonic_tyrant.remains<12
actions.implosion+=/bilescourge_bombers,if=cooldown.summon_demonic_tyrant.remains>9
actions.implosion+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions.implosion+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&(buff.demonic_core.stack>=3|buff.demonic_core.remains<=gcd*5.7)
actions.implosion+=/doom,cycle_targets=1,max_cycle_targets=7,if=refreshable
actions.implosion+=/call_action_list,name=build_a_shard

actions.nether_portal=call_action_list,name=nether_portal_building,if=cooldown.nether_portal.remains<20
actions.nether_portal+=/call_action_list,name=nether_portal_active,if=cooldown.nether_portal.remains>160

actions.nether_portal_active=grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.nether_portal_active+=/summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions.nether_portal_active+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.nether_portal_active+=/call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
actions.nether_portal_active+=/hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
actions.nether_portal_active+=/demonbolt,if=buff.demonic_core.up
actions.nether_portal_active+=/call_action_list,name=build_a_shard

actions.nether_portal_building=nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
actions.nether_portal_building+=/call_dreadstalkers
actions.nether_portal_building+=/hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
actions.nether_portal_building+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
actions.nether_portal_building+=/hand_of_guldan,if=soul_shard>=5
actions.nether_portal_building+=/call_action_list,name=build_a_shard

head=horrific_amalgams_hood,id=160616,bonus_id=4824/1507/4775,azerite_powers=458/30/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536,azerite_level=33
shoulders=amice_of_corrupting_horror,id=160726,bonus_id=4824/1507/4775,azerite_powers=483/22/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=robes_of_the_unraveler,id=160614,bonus_id=4824/1507/4775,azerite_powers=483/30/13
wrists=voidlashed_wristband,id=160617,bonus_id=4800/1507
hands=mutagenic_protofluid_handwraps,id=160715,bonus_id=4800/1507
waist=cord_of_septic_envelopment,id=160727,bonus_id=4800/1507
legs=leggings_of_lingering_infestation,id=160615,bonus_id=4800/1507
feet=volatile_walkers,id=160714,bonus_id=4800/1507
finger1=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=ignition_mages_fuse,id=159615,bonus_id=1542/4779
trinket2=vigilants_bloodshaper,id=160651,bonus_id=4800/1507
main_hand=tusk_of_the_reborn_prophet,id=160691,bonus_id=4800/1507,enchant=quick_navigation
off_hand=codex_of_imminent_ruin,id=160696,bonus_id=4800/1507

# Gear Summary
# gear_ilvl=385.25
# gear_stamina=7205
# gear_intellect=5476
# gear_crit_rating=913
# gear_haste_rating=1217
# gear_mastery_rating=742
# gear_versatility_rating=129
# gear_armor=1159
default_pet=felguard

DStr_GF_Imp : 17012 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17011.9 17011.9 15.6 / 0.092% 2182.1 / 12.8% 4.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
963.2 954.2 Mana 0.00% 47.3 100.0% 100%
Talents
  • 15: Demonic Strength (Demonology Warlock)
  • 30: Demonic Calling (Demonology Warlock)
  • 60: Summon Vilefiend (Demonology Warlock)
  • 90: Grimoire: Felguard (Demonology Warlock)
  • 100: Nether Portal (Demonology Warlock)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
DStr_GF_Imp 17012
Demonbolt 1253 7.4% 44.1 6.21sec 8524 7491 Direct 44.9 7110 14224 8366 17.7%  

Stats details: demonbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.10 44.93 0.00 0.00 1.1379 0.0000 375900.96 375900.96 0.00 7490.60 7490.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.00 82.35% 7109.79 6520 8308 7111.05 6921 7337 263083 263083 0.00
crit 7.93 17.65% 14223.57 13040 16616 14221.98 13233 16616 112818 112818 0.00
 
 

Action details: demonbolt

Static Values
  • id:264178
  • school:shadowflame
  • resource:mana
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:264178
  • name:Demonbolt
  • school:shadowflame
  • tooltip:
  • description:Send the fiery soul of a fallen demon at the enemy, causing {$s1=0} Shadowflame damage.$?c2[ |cFFFFFFFFGenerates 2 Soul Shards.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.667000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Hand of Gul'dan 1052 6.2% 60.4 4.90sec 5225 4741 Direct 60.3 4448 8903 5236 17.7%  

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.39 60.26 0.00 0.00 1.1021 0.0000 315524.01 315524.01 0.00 4741.01 4741.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.60 82.30% 4447.62 1634 5979 4441.25 4061 4806 220592 220592 0.00
crit 10.66 17.70% 8902.74 3267 11958 8886.69 4992 10948 94932 94932 0.00
 
 

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadowflame
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.7000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:2.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadowflame
  • tooltip:
  • description:Calls down a demonic meteor full of Wild Imps which burst forth to attack the target. Deals up to ${$m1*$86040m1} Shadowflame damage on impact to all enemies within $86040A1 yds of the target{$?s196283=false}[, applies Doom to each target,][] and summons up to ${$m1*{$104317m2=0}} Wild Imps, based on Soul Shards consumed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.160000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Heed My Call 139 (199) 0.8% (1.2%) 7.2 36.91sec 8264 0 Direct 7.2 4925 9849 5784 17.4%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.22 7.22 0.00 0.00 0.0000 0.0000 41737.62 41737.62 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.96 82.56% 4924.62 4925 4925 4919.70 0 4925 29339 29339 0.00
crit 1.26 17.44% 9849.24 9849 9849 7128.34 0 9849 12399 12399 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4620.00
  • base_dd_max:4620.00
 
    Heed My Call (_aoe) 60 0.4% 7.2 36.91sec 2480 0 Direct 7.2 2111 4221 2480 17.5%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.22 7.22 0.00 0.00 0.0000 0.0000 17899.79 17899.79 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.95 82.48% 2110.55 2111 2111 2108.86 0 2111 12562 12562 0.00
crit 1.26 17.52% 4221.10 4221 4221 3062.60 0 4221 5338 5338 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1980.00
  • base_dd_max:1980.00
 
Shadow Bolt 1342 7.9% 95.8 3.06sec 4202 2812 Direct 95.1 3594 7190 4231 17.7%  

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.77 95.09 0.00 0.00 1.4943 0.0000 402370.22 402370.22 0.00 2811.61 2811.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.25 82.29% 3594.49 3373 4297 3595.05 3552 3682 281258 281258 0.00
crit 16.84 17.71% 7190.39 6745 8595 7191.60 6964 7603 121113 121113 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=0} Shadow damage.$?c2[ |cFFFFFFFFGenerates 1 Soul Shard.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.345000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Volatile Blood Explosion 290 1.7% 7.3 36.87sec 11871 0 Direct 7.2 10240 20481 12044 17.6%  

Stats details: volatile_blood_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.32 7.22 0.00 0.00 0.0000 0.0000 86934.15 86934.15 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.95 82.38% 10240.44 10240 10240 10236.34 0 10240 60890 60890 0.00
crit 1.27 17.62% 20480.88 20481 20481 14966.32 0 20481 26045 26045 0.00
 
 

Action details: volatile_blood_explosion

Static Values
  • id:278057
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278057
  • name:Volatile Blood Explosion
  • school:shadow
  • tooltip:
  • description:Your damaging spells have a chance to launch an orb of charged blood at your target, dealing {$s1=4788} Shadow damage split among all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9607.38
  • base_dd_max:9607.38
 
pet - imp 3144 / 3144
Firebolt 3144 18.5% 103.8 2.89sec 9071 6939 Direct 103.0 7776 15544 9143 17.6%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.84 103.02 0.00 0.00 1.3071 0.0000 941862.31 941862.31 0.00 6939.49 6939.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.89 82.40% 7775.95 7027 9401 7777.11 7643 7942 660081 660081 0.00
crit 18.13 17.60% 15543.69 14053 18802 15546.60 14599 17192 281781 281781 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.568000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - grimoire_felguard 4430 / 959
Felstorm 708 0.9% 3.9 80.59sec 11557 3950 Periodic 19.5 1989 3976 2340 17.7% 3.8%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.94 0.00 19.48 19.48 2.9262 0.5924 45568.09 65145.06 30.05 3949.73 3949.73
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.0 82.35% 1988.83 1864 2388 1989.47 1914 2161 31898 45603 30.05
crit 3.4 17.65% 3976.21 3728 4775 3889.68 0 4775 13670 19542 29.40
 
 

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $ Physical damage every $t1 sec. Unable to use other abilities.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc89751=The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Legion Strike 2014 2.5% 18.5 13.86sec 7024 7025 Direct 18.5 5953 11913 7024 18.0%  

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.45 18.45 0.00 0.00 1.0000 0.0000 129618.73 185305.54 30.05 7024.64 7024.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.13 82.02% 5952.72 5456 6990 5955.20 5679 6422 90093 128798 30.05
crit 3.32 17.98% 11912.57 10913 13979 11559.76 0 13979 39526 56507 29.14
 
 

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy>=100
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w2%.
  • description:A strong attack that deals $<damage> damage to all enemies in front of it, and reduces the effectiveness of any healing the victim receives by {$s2=10}% for {$d=6 seconds}. |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1708 2.2% 41.0 6.35sec 2682 2267 Direct 41.0 2280 4561 2682 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.95 40.95 0.00 0.00 1.1832 0.0000 109823.06 157005.25 30.05 2266.64 2266.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.73 82.37% 2279.56 2071 2653 2280.18 2186 2421 76897 109933 30.05
crit 7.22 17.63% 4561.49 4142 5306 4561.13 0 5171 32926 47072 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - shivarra 1952 / 261
melee 842 0.7% 42.6 2.64sec 781 663 Direct 42.6 665 1329 781 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.56 42.56 0.00 0.00 1.1780 0.0000 33252.60 47538.59 30.05 663.34 663.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.07 82.42% 664.57 587 717 665.48 587 714 23309 33323 30.05
crit 7.48 17.58% 1328.82 1175 1433 1311.71 0 1433 9944 14216 29.64
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 422 0.3% 42.6 2.64sec 391 314 Direct 42.6 332 664 391 17.8%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.56 42.56 0.00 0.00 1.2453 0.0000 16654.37 23809.42 30.05 314.26 314.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.99 82.21% 332.32 294 358 332.75 294 357 11626 16621 30.05
crit 7.57 17.79% 664.14 587 717 657.75 0 717 5028 7188 29.73
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Multi-Slash 0 (92) 0.0% (0.5%) 0.0 0.00sec 0 3968

Stats details: multislash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 3967.70 3967.70
 
 

Action details: multislash

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (1) 172 0.1% 6.9 17.66sec 992 0 Direct 6.9 843 1688 992 17.5%  

Stats details: multislash1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.88 6.88 0.00 0.00 0.0000 0.0000 6826.74 9759.64 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.68 82.47% 843.46 749 914 842.42 0 914 4789 6847 29.95
crit 1.21 17.53% 1688.36 1498 1827 1138.58 0 1827 2038 2913 20.25
 
 

Action details: multislash1

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (2) 173 0.1% 6.9 17.66sec 995 0 Direct 6.9 844 1685 995 17.9%  

Stats details: multislash2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.88 6.88 0.00 0.00 0.0000 0.0000 6848.71 9791.05 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.65 82.06% 843.80 749 914 839.69 0 914 4767 6815 29.85
crit 1.24 17.94% 1685.20 1498 1827 1138.46 0 1827 2082 2976 20.28
 
 

Action details: multislash2

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (3) 172 0.1% 6.9 17.66sec 991 0 Direct 6.9 844 1685 991 17.5%  

Stats details: multislash3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.88 6.88 0.00 0.00 0.0000 0.0000 6822.56 9753.67 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.68 82.51% 843.81 749 914 842.50 0 914 4793 6853 29.94
crit 1.20 17.49% 1685.02 1498 1827 1130.19 0 1827 2029 2901 20.13
 
 

Action details: multislash3

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (4) 172 0.1% 6.9 17.66sec 990 0 Direct 6.9 844 1688 990 17.3%  

Stats details: multislash4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.88 6.88 0.00 0.00 0.0000 0.0000 6815.63 9743.76 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.69 82.65% 843.54 749 914 842.36 0 914 4800 6863 29.95
crit 1.19 17.35% 1687.59 1498 1827 1113.59 0 1827 2015 2881 19.82
 
 

Action details: multislash4

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - vicious_hellhound 1066 / 143
Demon Fangs 658 0.5% 9.3 12.46sec 2827 2827 Direct 9.3 2394 4781 2827 18.1%  

Stats details: demon_fangs

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.27 9.27 0.00 0.00 1.0000 0.0000 26200.08 26200.08 0.00 2826.94 2826.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.59 81.87% 2394.04 2116 2582 2392.70 0 2582 18166 18166 0.00
crit 1.68 18.13% 4780.73 4233 5163 3628.24 0 5163 8034 8034 0.00
 
 

Action details: demon_fangs

Static Values
  • id:272013
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272013
  • name:Demon Fangs
  • school:shadowflame
  • tooltip:
  • description:The Vicious Hellhound chomps at its target, dealing Shadowflame damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 408 0.3% 82.3 1.35sec 196 326 Direct 82.3 167 333 196 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.29 82.29 0.00 0.00 0.6008 0.0000 16121.78 23048.01 30.05 326.10 326.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.80 82.39% 166.56 147 179 166.70 147 178 11293 16144 30.05
crit 14.50 17.61% 333.13 294 358 332.82 0 358 4829 6904 30.00
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - vilefiend 3206 / 1517
Bile Spit 1167 3.2% 6.8 47.22sec 24266 0 Direct 6.8 8928 17858 10494 17.5%  
Periodic 33.2 2822 0 2822 0.0% 22.1%

Stats details: bile_spit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.79 6.78 33.19 33.19 0.0000 2.0000 164776.35 164776.35 0.00 2482.47 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.59 82.46% 8928.17 8474 10104 8927.26 8646 9801 49886 49886 0.00
crit 1.19 17.54% 17857.71 16947 20207 12980.90 0 20207 21226 21226 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.2 100.00% 2822.24 2502 3310 2822.91 2633 2885 93664 93664 0.00
 
 

Action details: bile_spit

Static Values
  • id:267997
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:65.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267997
  • name:Bile Spit
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:The Vilefiend spits a ball of bile at its target, dealing ${$m1*$<demoMastery>} Nature damage and an additional ${$m2*$<demoMastery>} Nature damage every $t2 sec for {$d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.680000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.200000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Headbutt 733 2.0% 28.5 10.24sec 3650 3650 Direct 28.5 3106 6209 3650 17.5%  

Stats details: headbutt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.54 28.54 0.00 0.00 1.0000 0.0000 104148.96 148893.45 30.05 3649.87 3649.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.53 82.47% 3105.73 2737 3621 3107.14 2952 3241 73087 104486 30.05
crit 5.00 17.53% 6209.26 5474 7243 6181.79 0 7243 31062 44407 29.90
 
 

Action details: headbutt

Static Values
  • id:267999
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267999
  • name:Headbutt
  • school:physical
  • tooltip:
  • description:The Vilefiend rams its bladed head into the target, dealing {$s1=0} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1306 3.6% 102.9 2.81sec 1802 1354 Direct 102.9 1531 3060 1802 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 102.87 102.87 0.00 0.00 1.3307 0.0000 185316.41 264932.06 30.05 1353.81 1353.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.66 82.30% 1530.78 1337 1775 1531.37 1473 1571 129592 185268 30.05
crit 18.21 17.70% 3060.34 2673 3550 3061.40 2837 3328 55724 79664 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - bilescourge 3916 / 524
Toxic Bile 3916 3.0% 55.0 2.03sec 2825 3032 Direct 55.0 2401 4803 2825 17.6%  

Stats details: toxic_bile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.96 54.96 0.00 0.00 0.9318 0.0000 155234.07 155234.07 0.00 3031.56 3031.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.27 82.37% 2401.11 2116 2582 2403.38 2116 2571 108688 108688 0.00
crit 9.69 17.63% 4803.06 4233 5163 4780.46 0 5163 46546 46546 0.00
 
 

Action details: toxic_bile

Static Values
  • id:272167
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272167
  • name:Toxic Bile
  • school:nature
  • tooltip:
  • description:The Bilescourge spits wads of Toxic Bile at its target, dealing Nature damage.
 
pet - dreadstalker 3375 / 2230
Dreadbite 1068 4.2% 29.1 20.94sec 7270 0 Direct 29.1 6175 12355 7270 17.7%  

Stats details: dreadbite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.10 29.10 0.00 0.00 0.0000 0.0000 211518.52 211518.52 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.94 82.28% 6174.66 5711 7613 6174.93 5959 6371 147830 147830 0.00
crit 5.15 17.72% 12355.46 11423 15227 12292.51 0 15227 63688 63688 0.00
 
 

Action details: dreadbite

Static Values
  • id:205196
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205196
  • name:Dreadbite
  • school:shadow
  • tooltip:
  • description:Bite the target, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 2307 9.0% 312.1 1.89sec 1464 1106 Direct 312.1 1244 2487 1464 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 312.14 312.14 0.00 0.00 1.3236 0.0000 457093.91 653470.64 30.05 1106.34 1106.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 256.76 82.26% 1243.80 1101 1473 1243.98 1225 1264 319358 456560 30.05
crit 55.38 17.74% 2487.16 2203 2947 2487.53 2385 2610 137736 196910 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.83
 
pet - darkhound 1316 / 177
Fel Bite 472 0.4% 9.0 12.98sec 2114 2114 Direct 9.0 1795 3592 2114 17.7%  

Stats details: fel_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.98 8.98 0.00 0.00 1.0000 0.0000 18974.47 27126.28 30.05 2113.91 2113.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.38 82.25% 1794.96 1586 1935 1794.74 0 1935 13252 18946 29.98
crit 1.59 17.75% 3591.82 3172 3870 2691.11 0 3870 5722 8180 22.49
 
 

Action details: fel_bite

Static Values
  • id:272435
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272435
  • name:Fel Bite
  • school:physical
  • tooltip:
  • description:The Darkhound bites its target, causing serious Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 844 0.7% 43.0 2.61sec 781 664 Direct 43.0 665 1329 781 17.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.97 42.97 0.00 0.00 1.1761 0.0000 33564.04 47983.83 30.05 664.17 664.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.45 82.49% 664.86 587 717 665.64 587 714 23566 33690 30.05
crit 7.52 17.51% 1329.07 1175 1433 1309.64 0 1433 9998 14293 29.59
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - wild_imp 2576 / 2476
Fel Firebolt 2576 14.6% 995.0 0.29sec 746 502 Direct 990.9 637 1274 750 17.7%  

Stats details: fel_firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 995.01 990.86 0.00 0.00 1.4875 0.0000 742730.91 742730.91 0.00 501.82 501.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 815.88 82.34% 637.09 569 761 637.11 627 648 519790 519790 0.00
crit 174.98 17.66% 1274.06 1138 1523 1274.13 1236 1318 222941 222941 0.00
 
 

Action details: fel_firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Fel Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.046000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - demonic_tyrant 4656 / 823
Demonfire 4656 4.8% 37.8 6.89sec 6523 4885 Direct 37.7 5561 11118 6538 17.6%  

Stats details: demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.76 37.68 0.00 0.00 1.3355 0.0000 246342.96 246342.96 0.00 4884.56 4884.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.06 82.43% 5561.10 5312 5917 5564.35 5466 5660 172744 172744 0.00
crit 6.62 17.57% 11118.11 10624 11834 11112.80 0 11834 73599 73599 0.00
 
 

Action details: demonfire

Static Values
  • id:270481
  • school:shadowflame
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:270481
  • name:Demonfire
  • school:shadowflame
  • tooltip:
  • description:Deal {$s1=0} Shadowflame damage to your enemy target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.357500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - void_terror 1838 / 248
Double Breath 0 (135) 0.0% (0.8%) 0.0 0.00sec 0 7430

Stats details: double_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 7429.69 7429.69
 
 

Action details: double_breath

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (1) 497 0.4% 7.1 17.75sec 2813 0 Direct 7.1 2389 4782 2813 17.7%  

Stats details: double_breath1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.08 7.08 0.00 0.00 0.0000 0.0000 19924.25 19924.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.83 82.27% 2388.88 2116 2582 2387.20 0 2582 13920 13920 0.00
crit 1.26 17.73% 4782.24 4233 5163 3275.73 0 5163 6004 6004 0.00
 
 

Action details: double_breath1

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (2) 498 0.4% 7.1 17.75sec 2821 0 Direct 7.1 2390 4774 2821 18.1%  

Stats details: double_breath2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.08 7.08 0.00 0.00 0.0000 0.0000 19980.60 19980.60 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.80 81.91% 2389.76 2116 2582 2382.79 0 2582 13864 13864 0.00
crit 1.28 18.09% 4774.11 4233 5163 3313.34 0 5163 6116 6116 0.00
 
 

Action details: double_breath2

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
melee 843 0.7% 42.9 2.75sec 782 665 Direct 42.9 665 1330 782 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.95 42.95 0.00 0.00 1.1757 0.0000 33598.87 48033.62 30.05 665.42 665.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.36 82.34% 664.87 587 717 665.79 587 714 23512 33613 30.05
crit 7.58 17.66% 1330.16 1175 1433 1316.91 0 1433 10087 14420 29.70
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - illidari_satyr 1270 / 171
melee 420 0.3% 42.6 2.74sec 392 333 Direct 42.6 332 665 392 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.55 42.55 0.00 0.00 1.1767 0.0000 16668.23 23829.24 30.05 332.87 332.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.97 82.17% 332.44 294 358 332.81 294 357 11625 16619 30.05
crit 7.59 17.83% 664.81 587 717 656.34 0 717 5043 7210 29.64
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 209 0.2% 42.6 2.74sec 195 157 Direct 42.6 166 332 195 17.6%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.55 42.55 0.00 0.00 1.2444 0.0000 8319.08 11893.13 30.05 157.10 157.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.05 82.38% 166.24 147 179 166.40 147 179 5827 8331 30.05
crit 7.50 17.62% 332.26 294 358 328.33 0 358 2492 3562 29.65
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Shadow Slash 641 0.5% 9.1 13.23sec 2817 2817 Direct 9.1 2396 4787 2816 17.6%  

Stats details: shadow_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.11 9.11 0.00 0.00 1.0000 0.0000 25666.60 25666.60 0.00 2816.79 2816.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.51 82.39% 2395.61 2116 2582 2395.00 0 2582 17987 17987 0.00
crit 1.60 17.61% 4786.65 4233 5163 3621.87 0 5163 7680 7680 0.00
 
 

Action details: shadow_slash

Static Values
  • id:272012
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272012
  • name:Shadow Slash
  • school:shadow
  • tooltip:
  • description:The Satyr strikes at out with its weapons, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - urzul 1342 / 182
Many Faced Bite 500 0.4% 9.5 12.04sec 2110 2110 Direct 9.5 1793 3589 2110 17.7%  

Stats details: many_faced_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.55 9.55 0.00 0.00 1.0000 0.0000 20142.74 28796.46 30.05 2109.85 2109.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.86 82.34% 1792.58 1586 1935 1792.59 0 1935 14093 20148 30.00
crit 1.69 17.66% 3588.66 3172 3870 2719.54 0 3870 6050 8649 22.77
 
 

Action details: many_faced_bite

Static Values
  • id:272439
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272439
  • name:Many Faced Bite
  • school:physical
  • tooltip:
  • description:The Ur'zul rears up and bites its target, dealing Physical damage. You're not sure which face actually bit you after thinking about it.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 843 0.7% 43.1 2.59sec 782 665 Direct 43.1 665 1330 782 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.13 43.13 0.00 0.00 1.1747 0.0000 33714.08 48198.33 30.05 665.43 665.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.55 82.42% 664.79 587 717 665.56 587 714 23634 33787 30.05
crit 7.58 17.58% 1329.64 1175 1433 1311.05 0 1433 10080 14411 29.59
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - wrathguard 1721 / 229
melee 836 0.6% 42.0 2.57sec 782 665 Direct 42.0 665 1330 782 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.05 42.05 0.00 0.00 1.1768 0.0000 32897.10 47030.36 30.05 664.83 664.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.61 82.30% 664.75 587 717 665.52 587 714 23004 32888 30.05
crit 7.44 17.70% 1329.61 1175 1433 1315.04 0 1433 9893 14143 29.69
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 417 0.3% 42.0 2.57sec 391 314 Direct 42.0 332 665 391 17.6%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.05 42.05 0.00 0.00 1.2443 0.0000 16433.09 23493.08 30.05 314.11 314.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.65 82.41% 332.39 294 358 332.79 294 357 11518 16466 30.05
crit 7.40 17.59% 664.65 587 717 653.19 0 717 4915 7027 29.51
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Overhead Assault 468 0.4% 8.8 12.74sec 2116 2116 Direct 8.8 1795 3586 2116 17.9%  

Stats details: overhead_assault

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.80 8.80 0.00 0.00 1.0000 0.0000 18626.99 26629.52 30.05 2116.22 2116.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.23 82.09% 1795.36 1586 1935 1797.85 0 1935 12973 18546 30.02
crit 1.58 17.91% 3585.92 3172 3870 2695.27 0 3870 5654 8084 22.56
 
 

Action details: overhead_assault

Static Values
  • id:272432
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272432
  • name:Overhead Assault
  • school:physical
  • tooltip:
  • description:The Wrathguard smashes its target with a heavy overhand swing.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - eye_of_guldan 985 / 83
Eye of Gul'dan 985 0.5% 28.1 4.75sec 870 1145 Periodic 61.2 400 0 400 0.0% 59.9%

Stats details: eye_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.14 0.00 61.16 61.16 0.7600 2.9380 24489.40 24489.40 0.00 121.79 1145.11
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.2 100.00% 400.40 181 461 399.59 379 405 24489 24489 0.00
 
 

Action details: eye_of_guldan

Static Values
  • id:272131
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272131
  • name:Eye of Gul'dan
  • school:shadowflame
  • tooltip:Suffering Shadow damage every $t1 sec.
  • description:The Eye of Gul'dan stares deep into the target's soul, causing Shadow Damage every $t1 sec for {$d=15 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.300000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - prince_malchezaar 4714 / 397
melee 3146 1.5% 21.0 1.60sec 3718 3173 Direct 21.0 3152 6304 3719 18.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.04 21.04 0.00 0.00 1.1718 0.0000 78251.02 111869.24 30.05 3173.20 3173.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.26 82.02% 3152.05 2784 3396 3159.25 2784 3380 54406 77779 30.05
crit 3.78 17.98% 6304.18 5567 6791 6105.71 0 6791 23845 34090 29.04
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 1568 0.8% 21.0 1.60sec 1850 1493 Direct 21.0 1576 3151 1851 17.4%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.04 21.04 0.00 0.00 1.2391 0.0000 38941.27 55671.23 30.05 1493.38 1493.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.38 82.58% 1576.11 1392 1698 1580.19 1392 1692 27387 39153 30.05
crit 3.67 17.42% 3151.25 2784 3396 3081.88 0 3396 11554 16518 29.30
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
DStr_GF_Imp
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_GF_Imp
  • harmful:false
  • if_expr:
 
Berserking 2.0 187.31sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:pet.demonic_tyrant.active|target.time_to_die<=15
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Call Dreadstalkers 14.6 20.94sec

Stats details: call_dreadstalkers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.61 0.00 0.00 0.00 1.2016 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: call_dreadstalkers

Static Values
  • id:104316
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:20.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
Spelldata
  • id:104316
  • name:Call Dreadstalkers
  • school:shadow
  • tooltip:
  • description:Summons {$s1=2} ferocious Dreadstalkers to attack the target for {$193332d=12 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_GF_Imp
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_GF_Imp
  • harmful:false
  • if_expr:
 
Grimoire: Felguard 3.0 120.74sec

Stats details: grimoire_felguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 1.1280 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: grimoire_felguard

Static Values
  • id:111898
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
Spelldata
  • id:111898
  • name:Grimoire: Felguard
  • school:shadow
  • tooltip:
  • description:Summons a Felguard who attacks the target for {$s1=15} sec that deals {$216187s1=25}% increased damage. This Felguard will stun their target when summoned.
 
Nether Portal 2.0 0.00sec

Stats details: nether_portal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.2382 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: nether_portal

Static Values
  • id:267217
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Spelldata
  • id:267217
  • name:Nether Portal
  • school:shadow
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Summon Demonic Tyrant 3.6 93.51sec

Stats details: summon_demonic_tyrant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.60 0.00 0.00 0.00 1.5115 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_demonic_tyrant

Static Values
  • id:265187
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
Spelldata
  • id:265187
  • name:Summon Demonic Tyrant
  • school:shadow
  • tooltip:
  • description:Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.
 
summon_random_demon 15.1 14.66sec

Stats details: summon_random_demon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.14 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_random_demon

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
 
Summon Vilefiend 6.8 47.22sec

Stats details: summon_vilefiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.79 0.00 0.00 0.00 1.5401 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_vilefiend

Static Values
  • id:264119
  • school:fire
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Spelldata
  • id:264119
  • name:Summon Vilefiend
  • school:fire
  • tooltip:
  • description:Summon a Vilefiend to fight for you for the next {$d=15 seconds}.
 
pet - grimoire_felguard
Axe Toss 4.0 80.15sec

Stats details: axe_toss

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.98 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: axe_toss

Static Values
  • id:89766
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89766
  • name:Axe Toss
  • school:physical
  • tooltip:Stunned for {$d=4 seconds}.
  • description:The $?s108499[Wrathguard][Felguard] hurls its weapon, stunning the target for {$89766d=4 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:28.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=7}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 100.0sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 187.3sec 187.3sec 6.76% 8.46% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Demonic Calling 12.8 15.2 23.2sec 10.2sec 51.57% 83.74% 15.2(15.2) 0.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_calling_1:51.57%

Trigger Attempt Success

  • trigger_pct:19.90%

Spelldata details

  • id:205146
  • name:Demonic Calling
  • tooltip:Your next Call Dreadstalkers costs {$205145s1=1} less Soul Shard and has no cast time.
  • description:{$@spelldesc205145=Shadow Bolt{$?s264178=true}[ and Demonbolt have][ has] a {$h=20}% chance to make your next Call Dreadstalkers cost {$s1=1} less Soul Shard and have no cast time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Demonic Core 23.4 30.0 12.3sec 5.3sec 38.56% 100.00% 4.4(4.4) 0.4

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_demonic_core
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_core_1:15.82%
  • demonic_core_2:15.66%
  • demonic_core_3:5.01%
  • demonic_core_4:2.06%

Trigger Attempt Success

  • trigger_pct:25.74%

Spelldata details

  • id:264173
  • name:Demonic Core
  • tooltip:The cast time of Demonbolt is reduced by {$s1=100}%.
  • description:{$@spelldesc267102=When your Wild Imps expend all of their energy or are imploded, you have a {$s1=10}% chance to absorb their life essence, granting you a stack of Demonic Core. When your summoned Dreadstalkers fade away, you have a {$s2=100}% chance to absorb their life essence, granting you a stack of Demonic Core. Demonic Core reduces the cast time of Demonbolt by {$264173s1=100}%. Maximum {$264173u=4} stacks.}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Demonic Power 3.6 0.0 93.5sec 93.5sec 17.69% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_demonic_power
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_power_1:17.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:265273
  • name:Demonic Power
  • tooltip:Damage dealt by your demons increased by {$s2=15}%.
  • description:{$@spelldesc265187=Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
dreadstalkers 11.6 17.6 26.6sec 10.1sec 66.08% 0.00% 0.0(0.0) 10.9

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_dreadstalkers
  • max_stacks:4
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • dreadstalkers_2:59.65%
  • dreadstalkers_4:6.43%

Trigger Attempt Success

  • trigger_pct:100.00%
eyes_of_guldan 0.1 0.5 181.7sec 2.6sec 1.20% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_eyes_of_guldan
  • max_stacks:4
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • eyes_of_guldan_4:1.20%

Trigger Attempt Success

  • trigger_pct:100.00%
grimoire_felguard 3.0 0.0 120.7sec 120.7sec 19.75% 0.00% 0.0(0.0) 2.9

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_grimoire_felguard
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • grimoire_felguard_1:19.75%

Trigger Attempt Success

  • trigger_pct:100.00%
Ignition Mage's Fuse 2.4 0.0 171.6sec 171.6sec 14.87% 0.00% 2.0(2.0) 2.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:275.80

Stack Uptimes

  • ignition_mages_fuse_1:3.13%
  • ignition_mages_fuse_2:3.09%
  • ignition_mages_fuse_3:3.05%
  • ignition_mages_fuse_4:2.88%
  • ignition_mages_fuse_5:2.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Nether Portal 2.0 0.0 182.8sec 0.0sec 10.14% 18.27% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_nether_portal
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • nether_portal_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267217
  • name:Nether Portal
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Overwhelming Power 4.3 2.9 67.2sec 37.1sec 43.84% 0.00% 2.9(40.1) 0.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • overwhelming_power_1:1.30%
  • overwhelming_power_2:1.33%
  • overwhelming_power_3:1.37%
  • overwhelming_power_4:1.40%
  • overwhelming_power_5:1.44%
  • overwhelming_power_6:1.47%
  • overwhelming_power_7:1.51%
  • overwhelming_power_8:1.55%
  • overwhelming_power_9:1.59%
  • overwhelming_power_10:1.63%
  • overwhelming_power_11:1.67%
  • overwhelming_power_12:1.72%
  • overwhelming_power_13:1.76%
  • overwhelming_power_14:1.81%
  • overwhelming_power_15:1.86%
  • overwhelming_power_16:1.91%
  • overwhelming_power_17:1.97%
  • overwhelming_power_18:2.02%
  • overwhelming_power_19:2.08%
  • overwhelming_power_20:2.13%
  • overwhelming_power_21:2.20%
  • overwhelming_power_22:2.26%
  • overwhelming_power_23:2.32%
  • overwhelming_power_24:2.38%
  • overwhelming_power_25:1.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
portal_summons 2.0 13.1 182.8sec 14.7sec 19.61% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_portal_summons
  • max_stacks:40
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • portal_summons_1:2.02%
  • portal_summons_2:0.76%
  • portal_summons_3:1.26%
  • portal_summons_4:1.96%
  • portal_summons_5:1.39%
  • portal_summons_6:1.78%
  • portal_summons_7:4.26%
  • portal_summons_8:6.14%
  • portal_summons_9:0.05%

Trigger Attempt Success

  • trigger_pct:100.00%
prince_malchezaar 0.1 0.0 180.9sec 87.0sec 1.15% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_prince_malchezaar
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • prince_malchezaar_1:1.16%

Trigger Attempt Success

  • trigger_pct:100.00%
Quick Navigation 6.0 22.4 52.3sec 10.3sec 67.56% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:17.64%
  • quick_navigation_2:17.18%
  • quick_navigation_3:16.70%
  • quick_navigation_4:16.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.4 0.0 52.2sec 52.2sec 17.48% 0.00% 0.0(0.0) 5.2

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:17.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Supreme Commander 4.4 0.1 82.6sec 79.9sec 17.07% 0.00% 0.1(0.1) 3.4

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_supreme_commander
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:838.00

Stack Uptimes

  • supreme_commander_1:17.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279878
  • name:Supreme Commander
  • tooltip:
  • description:When your Demonic Tyrant expires, consume its life essence, granting you a stack of Demonic Core and increasing your Intellect by {$s1=398} for {$279885d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tyrant 3.6 0.0 93.5sec 93.5sec 17.69% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_tyrant
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • tyrant_1:17.69%

Trigger Attempt Success

  • trigger_pct:100.00%
vilefiend 6.8 0.0 47.2sec 47.2sec 47.46% 0.00% 0.0(0.0) 6.4

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_vilefiend
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vilefiend_1:47.46%

Trigger Attempt Success

  • trigger_pct:100.00%
wild_imps 5.2 153.6 55.6sec 0.0sec 96.11% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_wild_imps
  • max_stacks:40
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • wild_imps_1:2.30%
  • wild_imps_2:2.75%
  • wild_imps_3:28.87%
  • wild_imps_4:7.67%
  • wild_imps_5:9.48%
  • wild_imps_6:25.97%
  • wild_imps_7:5.82%
  • wild_imps_8:4.01%
  • wild_imps_9:4.80%
  • wild_imps_10:1.51%
  • wild_imps_11:1.16%
  • wild_imps_12:1.13%
  • wild_imps_13:0.42%
  • wild_imps_14:0.17%
  • wild_imps_15:0.05%
  • wild_imps_16:0.01%
  • wild_imps_17:0.00%
grimoire_felguard: Grimoire of Service 3.0 0.0 120.7sec 120.7sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Imp_grimoire_felguard
  • cooldown name:buff_grimoire_of_service
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • grimoire_of_service_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216187
  • name:Grimoire of Service
  • tooltip:Summoned by a Grimoire of Service. Damage done increased by {$s1=25}%.
  • description:{$@spelldesc108501=Summons a second demon which fights for you for {$s1=25} sec and deals {$216187s1=25}% increased damage. 1.5 min cooldown. The demon will immmediately use one of its special abilities when summoned: $@spellname111859: Cleanses 1 harmful Magic effect from you. $@spellname111895 Taunts its target. $@spellname111896 Seduces its target. $@spellname111897 Interrupts its target.$?c2[ $@spellname111898 Stuns its target.][]}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
summon_random_demon 15.1 13.9sec
one_shard_hog 8.8 21.7sec
two_shard_hog 3.8 16.5sec
three_shard_hog 47.7 5.8sec
portal_summon 15.1 13.9sec

Resources

Resource Usage Type Count Total Average RPE APR
DStr_GF_Imp
call_dreadstalkers Soul Shard 14.6 17.0 1.2 1.2 0.0
demonbolt Mana 45.1 90198.3 2000.0 2045.3 4.2
grimoire_felguard Soul Shard 3.0 3.0 1.0 1.0 0.0
hand_of_guldan Soul Shard 60.4 159.6 2.6 2.6 1976.4
shadow_bolt Mana 95.8 191535.9 2000.0 2000.0 2.1
summon_demonic_tyrant Mana 3.6 7196.5 2000.0 2000.2 0.0
summon_vilefiend Soul Shard 6.8 6.8 1.0 1.0 0.0
pet - imp
firebolt Energy 103.8 4153.5 40.0 40.0 226.8
pet - grimoire_felguard
felstorm Energy 3.9 236.6 60.0 60.0 192.6
legion_strike Energy 18.5 1107.2 60.0 60.0 117.1
pet - wild_imp
fel_firebolt Energy 995.0 15584.3 15.7 15.7 47.7
Resource Gains Type Count Total Average Overflow
demonbolt Soul Shard 45.10 90.19 (48.50%) 2.00 0.01 0.01%
shadow_bolt Soul Shard 95.77 95.77 (51.50%) 1.00 0.00 0.00%
mana_regen Mana 553.87 286235.01 (100.00%) 516.79 13207.94 4.41%
pet - imp
energy_regen Energy 427.33 3982.57 (100.00%) 9.32 22.74 0.57%
pet - grimoire_felguard
energy_regen Energy 91.66 914.32 (100.00%) 9.98 48.43 5.03%
pet - bilescourge
energy_regen Energy 11.18 0.00 (0.00%) 0.00 155.61 100.00%
pet - demonic_tyrant
energy_regen Energy 37.77 0.00 (0.00%) 0.00 762.42 100.00%
pet - bilescourge
energy_regen Energy 12.29 0.00 (0.00%) 0.00 170.73 100.00%
pet - bilescourge
energy_regen Energy 13.83 0.00 (0.00%) 0.00 192.43 100.00%
pet - bilescourge
energy_regen Energy 12.84 0.00 (0.00%) 0.00 178.34 100.00%
pet - bilescourge
energy_regen Energy 0.70 0.00 (0.00%) 0.00 9.72 100.00%
Resource RPS-Gain RPS-Loss
Mana 954.16 963.15
Soul Shard 0.62 0.62
Combat End Resource Mean Min Max
Mana 97320.61 92884.00 100000.00
Soul Shard 2.55 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.7%

Statistics & Data Analysis

Fight Length
Sample Data DStr_GF_Imp Fight Length
Count 4999
Mean 299.99
Minimum 240.01
Maximum 359.96
Spread ( max - min ) 119.95
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data DStr_GF_Imp Damage Per Second
Count 4999
Mean 17011.94
Minimum 15446.97
Maximum 19202.45
Spread ( max - min ) 3755.48
Range [ ( max - min ) / 2 * 100% ] 11.04%
Standard Deviation 564.0906
5th Percentile 16148.79
95th Percentile 17991.02
( 95th Percentile - 5th Percentile ) 1842.22
Mean Distribution
Standard Deviation 7.9782
95.00% Confidence Intervall ( 16996.31 - 17027.58 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4224
0.1 Scale Factor Error with Delta=300 2717
0.05 Scale Factor Error with Delta=300 10866
0.01 Scale Factor Error with Delta=300 271633
Priority Target DPS
Sample Data DStr_GF_Imp Priority Target Damage Per Second
Count 4999
Mean 17011.94
Minimum 15446.97
Maximum 19202.45
Spread ( max - min ) 3755.48
Range [ ( max - min ) / 2 * 100% ] 11.04%
Standard Deviation 564.0906
5th Percentile 16148.79
95th Percentile 17991.02
( 95th Percentile - 5th Percentile ) 1842.22
Mean Distribution
Standard Deviation 7.9782
95.00% Confidence Intervall ( 16996.31 - 17027.58 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4224
0.1 Scale Factor Error with Delta=300 2717
0.05 Scale Factor Error with Delta=300 10866
0.01 Scale Factor Error with Delta=300 271633
DPS(e)
Sample Data DStr_GF_Imp Damage Per Second (Effective)
Count 4999
Mean 17011.94
Minimum 15446.97
Maximum 19202.45
Spread ( max - min ) 3755.48
Range [ ( max - min ) / 2 * 100% ] 11.04%
Damage
Sample Data DStr_GF_Imp Damage
Count 4999
Mean 1240366.75
Minimum 901633.94
Maximum 1671858.59
Spread ( max - min ) 770224.64
Range [ ( max - min ) / 2 * 100% ] 31.05%
DTPS
Sample Data DStr_GF_Imp Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data DStr_GF_Imp Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data DStr_GF_Imp Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data DStr_GF_Imp Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data DStr_GF_Imp Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data DStr_GF_Imp Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data DStr_GF_ImpTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data DStr_GF_Imp Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 inner_demons,if=talent.inner_demons.enabled
5 0.00 snapshot_stats
6 0.00 potion
7 0.00 demonbolt
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,if=pet.demonic_tyrant.active|target.time_to_die<30
9 2.38 use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
A 2.00 berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
0.00 demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
B 0.00 call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
C 0.00 call_action_list,name=implosion,if=spell_targets.implosion>1
D 1.98 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
E 4.82 summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
F 11.60 call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
G 1.63 summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
0.00 doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
H 44.44 hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
0.00 soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
I 40.32 demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
0.00 bilescourge_bombers
J 0.00 call_action_list,name=build_a_shard
actions.build_a_shard
# count action,conditions
0.00 demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
0.00 soul_strike
K 96.29 shadow_bolt
actions.nether_portal_active
# count action,conditions
O 1.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
P 2.00 summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Q 2.00 call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
R 0.00 call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
S 13.69 hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
T 1.95 summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
U 0.04 summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
V 3.77 demonbolt,if=buff.demonic_core.up
W 0.00 call_action_list,name=build_a_shard
actions.nether_portal_building
# count action,conditions
X 2.00 nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Y 1.02 call_dreadstalkers
Z 0.57 hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
a 1.90 hand_of_guldan,if=soul_shard>=5
b 0.00 call_action_list,name=build_a_shard

Sample Sequence

012367XOPQST9AKSKSKSKSKSKSKKKKKHFIIHKKHIIHKKHIIHKKIFKEHKKHKKIHIIHKFIHKIHKKHKKKKKFHIIKEG8HKKHKKKKFHKIHKIHIDIHIKKKFHKKHKKKKEHIIKHFKKIHIHKKKKKaKKKYZKKKKXSSVSVPST9AVQSVSVSKKKHKIHIIHKKKFHIIHKKHKIHIKIHEFKKDKKHKIHIKKKFHKKHKKKHKIHIIKHFIKEGHIKHKKKKK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask DStr_GF_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food DStr_GF_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 augmentation DStr_GF_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_imp Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 potion Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard battle_potion_of_intellect
0:00.000 precombat 7 demonbolt Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard battle_potion_of_intellect
0:00.000 nether_portal_building X nether_portal Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard archive_of_the_titans, battle_potion_of_intellect
0:01.276 nether_portal_active O grimoire_felguard Fluffy_Pillow 99276.0/100000: 99% mana | 5.0/5: 100% soul_shard bloodlust, nether_portal, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:02.257 nether_portal_active P summon_vilefiend Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, nether_portal, grimoire_felguard, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:03.565 nether_portal_active Q call_dreadstalkers Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, nether_portal, vilefiend, grimoire_felguard, portal_summons(2), quick_navigation, archive_of_the_titans, battle_potion_of_intellect
0:04.866 nether_portal_active S hand_of_guldan Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(3), quick_navigation, archive_of_the_titans, battle_potion_of_intellect
0:05.843 nether_portal_active T summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:07.143 default 9 use_items Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:07.143 default A berserking Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.143 build_a_shard K shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.236 nether_portal_active S hand_of_guldan Fluffy_Pillow 97097.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.057 build_a_shard K shadow_bolt Fluffy_Pillow 97918.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(5), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:10.150 nether_portal_active S hand_of_guldan Fluffy_Pillow 97011.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(5), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:10.972 build_a_shard K shadow_bolt Fluffy_Pillow 97833.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(6), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:12.067 nether_portal_active S hand_of_guldan Fluffy_Pillow 96928.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(6), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.863 build_a_shard K shadow_bolt Fluffy_Pillow 97724.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(7), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.923 nether_portal_active S hand_of_guldan Fluffy_Pillow 96784.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(7), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.717 build_a_shard K shadow_bolt Fluffy_Pillow 97578.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.778 nether_portal_active S hand_of_guldan Fluffy_Pillow 96639.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation, archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.550 build_a_shard K shadow_bolt Fluffy_Pillow 97411.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation, archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.577 nether_portal_active S hand_of_guldan Fluffy_Pillow 96438.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation, archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.462 build_a_shard K shadow_bolt Fluffy_Pillow 97323.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation, archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.642 build_a_shard K shadow_bolt Fluffy_Pillow 96503.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(2), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.781 build_a_shard K shadow_bolt Fluffy_Pillow 95642.0/100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(2), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.919 build_a_shard K shadow_bolt Fluffy_Pillow 94780.0/100000: 95% mana | 3.0/5: 60% soul_shard bloodlust, demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:23.053 build_a_shard K shadow_bolt Fluffy_Pillow 93914.0/100000: 94% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(5), ignition_mages_fuse(4)
0:24.183 default H hand_of_guldan Fluffy_Pillow 93044.0/100000: 93% mana | 5.0/5: 100% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(5), ignition_mages_fuse(5)
0:25.009 default F call_dreadstalkers Fluffy_Pillow 93870.0/100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(6), ignition_mages_fuse(5)
0:26.110 default I demonbolt Fluffy_Pillow 94971.0/100000: 95% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(8), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(6), ignition_mages_fuse(5)
0:26.936 default I demonbolt Fluffy_Pillow 93797.0/100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(5), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(6), ignition_mages_fuse(5)
0:27.762 default H hand_of_guldan Fluffy_Pillow 92623.0/100000: 93% mana | 4.0/5: 80% soul_shard bloodlust, supreme_commander, wild_imps(3), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(6)
0:28.726 build_a_shard K shadow_bolt Fluffy_Pillow 93587.0/100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, supreme_commander, wild_imps(3), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(4), archive_of_the_titans(6)
0:30.003 build_a_shard K shadow_bolt Fluffy_Pillow 92864.0/100000: 93% mana | 2.0/5: 40% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(4), dreadstalkers(4), vilefiend, grimoire_felguard, quick_navigation(4), archive_of_the_titans(7)
0:31.280 default H hand_of_guldan Fluffy_Pillow 92141.0/100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(4), vilefiend, quick_navigation(4), archive_of_the_titans(7)
0:32.239 default I demonbolt Fluffy_Pillow 93100.0/100000: 93% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(7)
0:33.197 default I demonbolt Fluffy_Pillow 92058.0/100000: 92% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(7)
0:34.156 default H hand_of_guldan Fluffy_Pillow 91017.0/100000: 91% mana | 4.0/5: 80% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(5), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(7)
0:35.115 build_a_shard K shadow_bolt Fluffy_Pillow 91976.0/100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(8)
0:36.392 build_a_shard K shadow_bolt Fluffy_Pillow 91253.0/100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(8)
0:37.669 default H hand_of_guldan Fluffy_Pillow 90530.0/100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(8)
0:38.628 default I demonbolt Fluffy_Pillow 91489.0/100000: 91% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(2), demonic_calling, wild_imps(6), quick_navigation(4), archive_of_the_titans(8)
0:39.587 default I demonbolt Fluffy_Pillow 90448.0/100000: 90% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, demonic_calling, wild_imps(6), quick_navigation(4), archive_of_the_titans(8)
0:40.546 default H hand_of_guldan Fluffy_Pillow 89407.0/100000: 89% mana | 4.0/5: 80% soul_shard bloodlust, demonic_calling, wild_imps(5), quick_navigation(4), archive_of_the_titans(9)
0:41.504 build_a_shard K shadow_bolt Fluffy_Pillow 90365.0/100000: 90% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(6), quick_navigation(4), archive_of_the_titans(9)
0:43.164 build_a_shard K shadow_bolt Fluffy_Pillow 90025.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(7), quick_navigation(4), archive_of_the_titans(9)
0:44.824 default I demonbolt Fluffy_Pillow 89685.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(6), quick_navigation(4), archive_of_the_titans(9)
0:46.069 default F call_dreadstalkers Fluffy_Pillow 88930.0/100000: 89% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(6), quick_navigation(4), archive_of_the_titans(10)
0:47.350 build_a_shard K shadow_bolt Fluffy_Pillow 90211.0/100000: 90% mana | 4.0/5: 80% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(10)
0:49.010 default E summon_vilefiend Fluffy_Pillow 89871.0/100000: 90% mana | 5.0/5: 100% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(10)
0:50.593 default H hand_of_guldan Fluffy_Pillow 91454.0/100000: 91% mana | 4.0/5: 80% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(11)
0:51.779 build_a_shard K shadow_bolt Fluffy_Pillow 92640.0/100000: 93% mana | 1.0/5: 20% soul_shard dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(11)
0:53.361 build_a_shard K shadow_bolt Fluffy_Pillow 92222.0/100000: 92% mana | 2.0/5: 40% soul_shard wild_imps(2), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(11)
0:54.942 default H hand_of_guldan Fluffy_Pillow 91803.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(11)
0:56.129 build_a_shard K shadow_bolt Fluffy_Pillow 92990.0/100000: 93% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(12)
0:57.710 build_a_shard K shadow_bolt Fluffy_Pillow 92571.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(12)
0:59.294 default I demonbolt Fluffy_Pillow 92155.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(6), vilefiend, archive_of_the_titans(12)
1:00.570 default H hand_of_guldan Fluffy_Pillow 91431.0/100000: 91% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(6), vilefiend, archive_of_the_titans(13)
1:01.847 default I demonbolt Fluffy_Pillow 92708.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(3), vilefiend, archive_of_the_titans(13)
1:03.124 default I demonbolt Fluffy_Pillow 91985.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(4), vilefiend, archive_of_the_titans(13)
1:04.401 default H hand_of_guldan Fluffy_Pillow 91262.0/100000: 91% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(6), vilefiend, archive_of_the_titans(13)
1:05.676 build_a_shard K shadow_bolt Fluffy_Pillow 92537.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(5), archive_of_the_titans(14)
1:07.375 default F call_dreadstalkers Fluffy_Pillow 92236.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(5), archive_of_the_titans(14)
1:08.650 default I demonbolt Fluffy_Pillow 93511.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(6), dreadstalkers(2), archive_of_the_titans(14)
1:09.927 default H hand_of_guldan Fluffy_Pillow 92788.0/100000: 93% mana | 4.0/5: 80% soul_shard wild_imps(6), dreadstalkers(2), archive_of_the_titans(14)
1:11.204 build_a_shard K shadow_bolt Fluffy_Pillow 94065.0/100000: 94% mana | 1.0/5: 20% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation, archive_of_the_titans(15)
1:12.895 default I demonbolt Fluffy_Pillow 93756.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(5), dreadstalkers(2), quick_navigation, archive_of_the_titans(15)
1:14.163 default H hand_of_guldan Fluffy_Pillow 93024.0/100000: 93% mana | 4.0/5: 80% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation, archive_of_the_titans(15)
1:15.432 build_a_shard K shadow_bolt Fluffy_Pillow 94293.0/100000: 94% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(16)
1:17.112 build_a_shard K shadow_bolt Fluffy_Pillow 93973.0/100000: 94% mana | 2.0/5: 40% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(16)
1:18.790 default H hand_of_guldan Fluffy_Pillow 93651.0/100000: 94% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(16)
1:20.048 build_a_shard K shadow_bolt Fluffy_Pillow 94909.0/100000: 95% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(6), quick_navigation(2), archive_of_the_titans(17)
1:21.728 build_a_shard K shadow_bolt Fluffy_Pillow 94589.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(5), quick_navigation(2), archive_of_the_titans(17)
1:23.407 build_a_shard K shadow_bolt Fluffy_Pillow 94268.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(6), quick_navigation(3), archive_of_the_titans(17)
1:25.077 build_a_shard K shadow_bolt Fluffy_Pillow 93938.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(5), quick_navigation(3), archive_of_the_titans(18)
1:26.746 build_a_shard K shadow_bolt Fluffy_Pillow 93607.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(3), quick_navigation(3), archive_of_the_titans(18)
1:28.415 default F call_dreadstalkers Fluffy_Pillow 93276.0/100000: 93% mana | 5.0/5: 100% soul_shard demonic_core(2), wild_imps(3), quick_navigation(3), archive_of_the_titans(18)
1:30.084 default H hand_of_guldan Fluffy_Pillow 94945.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps, dreadstalkers(2), quick_navigation(3), archive_of_the_titans(19)
1:31.336 default I demonbolt Fluffy_Pillow 96197.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_core(2), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(19)
1:32.589 default I demonbolt Fluffy_Pillow 95450.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps, dreadstalkers(2), quick_navigation(3), archive_of_the_titans(19)
1:33.841 build_a_shard K shadow_bolt Fluffy_Pillow 94702.0/100000: 95% mana | 4.0/5: 80% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(19)
1:35.511 default E summon_vilefiend Fluffy_Pillow 94372.0/100000: 94% mana | 5.0/5: 100% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
1:37.248 default G summon_demonic_tyrant Fluffy_Pillow 96109.0/100000: 96% mana | 4.0/5: 80% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
1:38.908 default 8 potion Fluffy_Pillow 95769.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_power, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20)
1:38.908 default H hand_of_guldan Fluffy_Pillow 95769.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_power, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:40.157 build_a_shard K shadow_bolt Fluffy_Pillow 97018.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:41.738 build_a_shard K shadow_bolt Fluffy_Pillow 96599.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:43.320 default H hand_of_guldan Fluffy_Pillow 96181.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:44.506 build_a_shard K shadow_bolt Fluffy_Pillow 97367.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:46.089 build_a_shard K shadow_bolt Fluffy_Pillow 96950.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:47.672 build_a_shard K shadow_bolt Fluffy_Pillow 96533.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:49.254 build_a_shard K shadow_bolt Fluffy_Pillow 96115.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(25), archive_of_the_titans(20), battle_potion_of_intellect
1:50.635 default F call_dreadstalkers Fluffy_Pillow 95496.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, overwhelming_power(24), archive_of_the_titans(20), battle_potion_of_intellect
1:51.745 default H hand_of_guldan Fluffy_Pillow 96606.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(9), dreadstalkers(4), vilefiend, tyrant, overwhelming_power(23), archive_of_the_titans(20), battle_potion_of_intellect
1:52.862 build_a_shard K shadow_bolt Fluffy_Pillow 97723.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(9), dreadstalkers(4), vilefiend, tyrant, quick_navigation, overwhelming_power(22), archive_of_the_titans(20), battle_potion_of_intellect
1:54.348 default I demonbolt Fluffy_Pillow 97209.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, quick_navigation, overwhelming_power(20), archive_of_the_titans(20), battle_potion_of_intellect
1:55.476 default H hand_of_guldan Fluffy_Pillow 96337.0/100000: 96% mana | 3.0/5: 60% soul_shard supreme_commander, wild_imps(12), dreadstalkers(4), vilefiend, quick_navigation, overwhelming_power(19), archive_of_the_titans(20), battle_potion_of_intellect
1:56.611 build_a_shard K shadow_bolt Fluffy_Pillow 97472.0/100000: 97% mana | 0.0/5: 0% soul_shard supreme_commander, wild_imps(10), dreadstalkers(4), vilefiend, quick_navigation(2), overwhelming_power(18), archive_of_the_titans(20), battle_potion_of_intellect
1:58.121 default I demonbolt Fluffy_Pillow 96982.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core(2), supreme_commander, wild_imps(10), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(16), archive_of_the_titans(20), battle_potion_of_intellect
1:59.268 default H hand_of_guldan Fluffy_Pillow 96129.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core, supreme_commander, wild_imps(12), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(15), archive_of_the_titans(20), battle_potion_of_intellect
2:00.423 default I demonbolt Fluffy_Pillow 97284.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core, supreme_commander, wild_imps(10), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(14), archive_of_the_titans(20), battle_potion_of_intellect
2:01.585 default D grimoire_felguard Fluffy_Pillow 96446.0/100000: 96% mana | 2.0/5: 40% soul_shard supreme_commander, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(13), archive_of_the_titans(20), battle_potion_of_intellect
2:02.754 default I demonbolt Fluffy_Pillow 97615.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), supreme_commander, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation(2), overwhelming_power(12), archive_of_the_titans(20), battle_potion_of_intellect
2:03.929 default H hand_of_guldan Fluffy_Pillow 96790.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, supreme_commander, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation(2), overwhelming_power(11), archive_of_the_titans(20)
2:05.109 default I demonbolt Fluffy_Pillow 97970.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, supreme_commander, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation(3), overwhelming_power(25), archive_of_the_titans(20)
2:06.196 build_a_shard K shadow_bolt Fluffy_Pillow 97057.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_calling, supreme_commander, wild_imps(5), vilefiend, grimoire_felguard, quick_navigation(3), overwhelming_power(24), archive_of_the_titans(20)
2:07.652 build_a_shard K shadow_bolt Fluffy_Pillow 96513.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, supreme_commander, wild_imps(6), grimoire_felguard, quick_navigation(4), overwhelming_power(23), archive_of_the_titans(20)
2:09.108 build_a_shard K shadow_bolt Fluffy_Pillow 95969.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), grimoire_felguard, quick_navigation_final, overwhelming_power(21), archive_of_the_titans(20)
2:10.519 default F call_dreadstalkers Fluffy_Pillow 95380.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(3), grimoire_felguard, quick_navigation_final, overwhelming_power(20), archive_of_the_titans(20)
2:11.699 default H hand_of_guldan Fluffy_Pillow 96560.0/100000: 97% mana | 4.0/5: 80% soul_shard wild_imps(3), dreadstalkers(2), grimoire_felguard, quick_navigation_final, overwhelming_power(19), archive_of_the_titans(20)
2:12.769 build_a_shard K shadow_bolt Fluffy_Pillow 97630.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(3), dreadstalkers(2), grimoire_felguard, quick_navigation_final, overwhelming_power(18), archive_of_the_titans(20)
2:14.203 build_a_shard K shadow_bolt Fluffy_Pillow 97064.0/100000: 97% mana | 2.0/5: 40% soul_shard wild_imps(2), dreadstalkers(2), grimoire_felguard, quick_navigation_final, overwhelming_power(16), archive_of_the_titans(20)
2:15.651 default H hand_of_guldan Fluffy_Pillow 96512.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), grimoire_felguard, quick_navigation_final, overwhelming_power(15), archive_of_the_titans(20)
2:16.744 build_a_shard K shadow_bolt Fluffy_Pillow 97605.0/100000: 98% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation_final, overwhelming_power(14), archive_of_the_titans(20)
2:18.206 build_a_shard K shadow_bolt Fluffy_Pillow 97067.0/100000: 97% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(12), archive_of_the_titans(20)
2:19.686 build_a_shard K shadow_bolt Fluffy_Pillow 96547.0/100000: 97% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), overwhelming_power(11), archive_of_the_titans(20)
2:21.277 build_a_shard K shadow_bolt Fluffy_Pillow 96138.0/100000: 96% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation, overwhelming_power(9), archive_of_the_titans(20)
2:22.877 default E summon_vilefiend Fluffy_Pillow 95738.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(3), quick_navigation(2), overwhelming_power(8), archive_of_the_titans(20)
2:24.477 default H hand_of_guldan Fluffy_Pillow 97338.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(3), vilefiend, quick_navigation(2), overwhelming_power(6), archive_of_the_titans(20)
2:25.693 default I demonbolt Fluffy_Pillow 98554.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(3), vilefiend, quick_navigation(2), overwhelming_power(5), archive_of_the_titans(20)
2:26.916 default I demonbolt Fluffy_Pillow 97777.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps, vilefiend, quick_navigation(2), overwhelming_power(4), archive_of_the_titans(20)
2:28.147 build_a_shard K shadow_bolt Fluffy_Pillow 97008.0/100000: 97% mana | 4.0/5: 80% soul_shard wild_imps(3), vilefiend, quick_navigation(3), overwhelming_power(2), archive_of_the_titans(20)
2:29.797 default H hand_of_guldan Fluffy_Pillow 96658.0/100000: 97% mana | 5.0/5: 100% soul_shard wild_imps(3), vilefiend, quick_navigation(4), overwhelming_power, archive_of_the_titans(20)
2:31.037 default F call_dreadstalkers Fluffy_Pillow 97898.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(3), vilefiend, quick_navigation(4), archive_of_the_titans(20)
2:32.697 build_a_shard K shadow_bolt Fluffy_Pillow 99558.0/100000: 100% mana | 0.0/5: 0% soul_shard wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
2:34.277 build_a_shard K shadow_bolt Fluffy_Pillow 98002.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
2:35.858 default I demonbolt Fluffy_Pillow 97583.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
2:37.046 default H hand_of_guldan Fluffy_Pillow 96771.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
2:38.234 default I demonbolt Fluffy_Pillow 97959.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
2:39.421 default H hand_of_guldan Fluffy_Pillow 97146.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
2:40.609 build_a_shard K shadow_bolt Fluffy_Pillow 98334.0/100000: 98% mana | 0.0/5: 0% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(25), archive_of_the_titans(20)
2:41.990 build_a_shard K shadow_bolt Fluffy_Pillow 97715.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(24), archive_of_the_titans(20)
2:43.380 build_a_shard K shadow_bolt Fluffy_Pillow 97105.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), overwhelming_power(22), archive_of_the_titans(20)
2:44.875 build_a_shard K shadow_bolt Fluffy_Pillow 96600.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(6), overwhelming_power(21), archive_of_the_titans(20)
2:46.379 build_a_shard K shadow_bolt Fluffy_Pillow 96104.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(6), overwhelming_power(19), archive_of_the_titans(20)
2:47.900 nether_portal_building a hand_of_guldan Fluffy_Pillow 95625.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_core(3), demonic_calling, wild_imps(3), overwhelming_power(25), archive_of_the_titans(20)
2:49.004 build_a_shard K shadow_bolt Fluffy_Pillow 96729.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, wild_imps(3), overwhelming_power(23), archive_of_the_titans(20)
2:50.490 build_a_shard K shadow_bolt Fluffy_Pillow 96215.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core(3), demonic_calling, wild_imps, overwhelming_power(22), archive_of_the_titans(20)
2:51.986 build_a_shard K shadow_bolt Fluffy_Pillow 95711.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, wild_imps(3), overwhelming_power(21), archive_of_the_titans(20)
2:53.488 nether_portal_building Y call_dreadstalkers Fluffy_Pillow 95213.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_core(3), demonic_calling, wild_imps(3), overwhelming_power(19), archive_of_the_titans(20)
2:54.629 nether_portal_building Z hand_of_guldan Fluffy_Pillow 96354.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core(3), wild_imps(3), dreadstalkers(2), overwhelming_power(18), archive_of_the_titans(20)
2:55.776 build_a_shard K shadow_bolt Fluffy_Pillow 97501.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(3), wild_imps(3), dreadstalkers(2), quick_navigation, overwhelming_power(17), archive_of_the_titans(20)
2:57.305 build_a_shard K shadow_bolt Fluffy_Pillow 97030.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(3), wild_imps(4), dreadstalkers(2), quick_navigation, overwhelming_power(15), archive_of_the_titans(20)
2:58.849 build_a_shard K shadow_bolt Fluffy_Pillow 96574.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(4), wild_imps(3), dreadstalkers(2), quick_navigation, overwhelming_power(14), archive_of_the_titans(20)
3:00.403 build_a_shard K shadow_bolt Fluffy_Pillow 96128.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core(4), wild_imps(3), dreadstalkers(2), quick_navigation, overwhelming_power(12), archive_of_the_titans(20)
3:01.979 nether_portal_building X nether_portal Fluffy_Pillow 95704.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_core(4), wild_imps(3), dreadstalkers(2), quick_navigation, overwhelming_power(11), archive_of_the_titans(20)
3:03.166 nether_portal_active S hand_of_guldan Fluffy_Pillow 96891.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(4), nether_portal, wild_imps(3), dreadstalkers(2), portal_summons, quick_navigation, overwhelming_power(9), archive_of_the_titans(20)
3:04.369 nether_portal_active S hand_of_guldan Fluffy_Pillow 98094.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(4), nether_portal, wild_imps(3), dreadstalkers(2), portal_summons(2), quick_navigation, overwhelming_power(8), archive_of_the_titans(20)
3:05.578 nether_portal_active V demonbolt Fluffy_Pillow 99303.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core(4), nether_portal, wild_imps(2), portal_summons(3), quick_navigation, overwhelming_power(7), archive_of_the_titans(20)
3:06.792 nether_portal_active S hand_of_guldan Fluffy_Pillow 98517.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, nether_portal, wild_imps(4), portal_summons(3), quick_navigation, overwhelming_power(6), archive_of_the_titans(20)
3:08.015 nether_portal_active V demonbolt Fluffy_Pillow 99740.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, nether_portal, wild_imps(5), portal_summons(4), quick_navigation(2), overwhelming_power(4), archive_of_the_titans(20)
3:09.246 nether_portal_active P summon_vilefiend Fluffy_Pillow 98971.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(6), portal_summons(4), quick_navigation(2), overwhelming_power(3), archive_of_the_titans(20)
3:11.123 nether_portal_active S hand_of_guldan Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(7), vilefiend, portal_summons(5), quick_navigation(3), overwhelming_power, archive_of_the_titans(20)
3:12.370 nether_portal_active T summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(7), vilefiend, portal_summons(6), quick_navigation(3), archive_of_the_titans(20)
3:14.038 default 9 use_items Fluffy_Pillow 98003.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_power, demonic_calling, nether_portal, wild_imps(7), vilefiend, tyrant, portal_summons(6), quick_navigation(3), archive_of_the_titans(20)
3:14.038 default A berserking Fluffy_Pillow 98003.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_power, demonic_calling, nether_portal, wild_imps(7), vilefiend, tyrant, portal_summons(6), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse
3:14.038 nether_portal_active V demonbolt Fluffy_Pillow 98003.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_core(2), demonic_power, demonic_calling, nether_portal, wild_imps(7), vilefiend, tyrant, portal_summons(6), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse
3:15.093 nether_portal_active Q call_dreadstalkers Fluffy_Pillow 97058.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_core(2), demonic_power, demonic_calling, nether_portal, wild_imps(4), vilefiend, tyrant, portal_summons(6), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse
3:16.147 nether_portal_active S hand_of_guldan Fluffy_Pillow 98112.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_core(2), demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse
3:17.201 nether_portal_active V demonbolt Fluffy_Pillow 99166.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_core(2), demonic_power, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse
3:18.251 nether_portal_active S hand_of_guldan Fluffy_Pillow 98216.0/100000: 98% mana | 2.0/5: 40% soul_shard berserking, demonic_core, demonic_power, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse(2)
3:19.267 nether_portal_active V demonbolt Fluffy_Pillow 99232.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_core, demonic_power, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse(2)
3:20.282 nether_portal_active S hand_of_guldan Fluffy_Pillow 98247.0/100000: 98% mana | 2.0/5: 40% soul_shard berserking, demonic_power, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse(2)
3:21.299 build_a_shard K shadow_bolt Fluffy_Pillow 99264.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse(2)
3:22.649 build_a_shard K shadow_bolt Fluffy_Pillow 98002.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation_final, overwhelming_power(25), archive_of_the_titans(20), ignition_mages_fuse(3)
3:23.760 build_a_shard K shadow_bolt Fluffy_Pillow 97113.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation_final, overwhelming_power(24), archive_of_the_titans(20), ignition_mages_fuse(3)
3:24.876 default H hand_of_guldan Fluffy_Pillow 96229.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation_final, overwhelming_power(23), archive_of_the_titans(20), ignition_mages_fuse(3)
3:25.842 build_a_shard K shadow_bolt Fluffy_Pillow 97195.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation_final, overwhelming_power(22), archive_of_the_titans(20), ignition_mages_fuse(3)
3:27.134 default I demonbolt Fluffy_Pillow 96487.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_power, demonic_calling, wild_imps(9), vilefiend, tyrant, portal_summons(7), quick_navigation_final, overwhelming_power(20), archive_of_the_titans(20), ignition_mages_fuse(4)
3:28.088 default H hand_of_guldan Fluffy_Pillow 95441.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core, demonic_power, demonic_calling, wild_imps(11), vilefiend, tyrant, portal_summons(7), quick_navigation_final, overwhelming_power(19), archive_of_the_titans(20), ignition_mages_fuse(4)
3:29.048 default I demonbolt Fluffy_Pillow 96401.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(11), vilefiend, portal_summons(7), quick_navigation_final, overwhelming_power(18), archive_of_the_titans(20), ignition_mages_fuse(4)
3:30.012 default I demonbolt Fluffy_Pillow 95365.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(11), vilefiend, portal_summons(7), quick_navigation_final, overwhelming_power(17), archive_of_the_titans(20), ignition_mages_fuse(4)
3:30.981 default H hand_of_guldan Fluffy_Pillow 94334.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_calling, supreme_commander, wild_imps(13), vilefiend, quick_navigation_final, overwhelming_power(17), archive_of_the_titans(20), ignition_mages_fuse(5)
3:31.927 build_a_shard K shadow_bolt Fluffy_Pillow 95280.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_calling, supreme_commander, wild_imps(14), vilefiend, quick_navigation_final, overwhelming_power(16), archive_of_the_titans(20), ignition_mages_fuse(5)
3:33.189 build_a_shard K shadow_bolt Fluffy_Pillow 94542.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_calling, supreme_commander, wild_imps(13), vilefiend, overwhelming_power(14), archive_of_the_titans(20), ignition_mages_fuse(5)
3:34.540 build_a_shard K shadow_bolt Fluffy_Pillow 93893.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_calling, supreme_commander, wild_imps(13), vilefiend, overwhelming_power(13), archive_of_the_titans(20)
3:36.115 default F call_dreadstalkers Fluffy_Pillow 93468.0/100000: 93% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(6), vilefiend, overwhelming_power(11), archive_of_the_titans(20)
3:37.308 default H hand_of_guldan Fluffy_Pillow 94661.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core(2), supreme_commander, wild_imps(5), dreadstalkers(2), vilefiend, overwhelming_power(10), archive_of_the_titans(20)
3:38.509 default I demonbolt Fluffy_Pillow 95862.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_core(2), supreme_commander, wild_imps(3), dreadstalkers(2), vilefiend, overwhelming_power(9), archive_of_the_titans(20)
3:39.718 default I demonbolt Fluffy_Pillow 95071.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core, supreme_commander, wild_imps(4), dreadstalkers(2), vilefiend, overwhelming_power(8), archive_of_the_titans(20)
3:40.933 default H hand_of_guldan Fluffy_Pillow 94286.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_calling, supreme_commander, wild_imps(5), dreadstalkers(2), vilefiend, overwhelming_power(7), archive_of_the_titans(20)
3:42.156 build_a_shard K shadow_bolt Fluffy_Pillow 95509.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_calling, supreme_commander, wild_imps(3), dreadstalkers(2), quick_navigation, overwhelming_power(5), archive_of_the_titans(20)
3:43.795 build_a_shard K shadow_bolt Fluffy_Pillow 95148.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_calling, supreme_commander, wild_imps(5), dreadstalkers(2), quick_navigation, overwhelming_power(4), archive_of_the_titans(20)
3:45.443 default H hand_of_guldan Fluffy_Pillow 94796.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation, overwhelming_power(2), archive_of_the_titans(20)
3:46.695 build_a_shard K shadow_bolt Fluffy_Pillow 96048.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation, overwhelming_power, archive_of_the_titans(20)
3:48.374 default I demonbolt Fluffy_Pillow 95727.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation, archive_of_the_titans(20)
3:49.642 default H hand_of_guldan Fluffy_Pillow 94995.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(6), quick_navigation, archive_of_the_titans(20)
3:50.910 default I demonbolt Fluffy_Pillow 96263.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(6), quick_navigation, archive_of_the_titans(20)
3:52.179 build_a_shard K shadow_bolt Fluffy_Pillow 95532.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(5), quick_navigation, archive_of_the_titans(20)
3:53.868 default I demonbolt Fluffy_Pillow 95221.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(6), quick_navigation, archive_of_the_titans(20)
3:55.135 default H hand_of_guldan Fluffy_Pillow 94488.0/100000: 94% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(6), quick_navigation, archive_of_the_titans(20)
3:56.404 default E summon_vilefiend Fluffy_Pillow 95757.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(5), quick_navigation(2), archive_of_the_titans(20)
3:58.085 default F call_dreadstalkers Fluffy_Pillow 97438.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), vilefiend, quick_navigation(2), archive_of_the_titans(20)
3:59.345 build_a_shard K shadow_bolt Fluffy_Pillow 98698.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
4:01.025 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
4:02.704 default D grimoire_felguard Fluffy_Pillow 97684.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
4:03.965 build_a_shard K shadow_bolt Fluffy_Pillow 98945.0/100000: 99% mana | 1.0/5: 20% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation(2), archive_of_the_titans(20)
4:05.645 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation(2), archive_of_the_titans(20)
4:07.325 default H hand_of_guldan Fluffy_Pillow 97685.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_calling, dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation(2), archive_of_the_titans(20)
4:08.583 build_a_shard K shadow_bolt Fluffy_Pillow 98943.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_calling, dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation(3), archive_of_the_titans(20)
4:10.252 default I demonbolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(2), vilefiend, grimoire_felguard, quick_navigation(3), archive_of_the_titans(20)
4:11.505 default H hand_of_guldan Fluffy_Pillow 97257.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(3), vilefiend, grimoire_felguard, quick_navigation(3), archive_of_the_titans(20)
4:12.757 default I demonbolt Fluffy_Pillow 98509.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(3), vilefiend, grimoire_felguard, quick_navigation(4), archive_of_the_titans(20)
4:14.003 build_a_shard K shadow_bolt Fluffy_Pillow 97755.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), grimoire_felguard, quick_navigation(4), archive_of_the_titans(20)
4:15.661 build_a_shard K shadow_bolt Fluffy_Pillow 97413.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), grimoire_felguard, quick_navigation(4), archive_of_the_titans(20)
4:17.320 build_a_shard K shadow_bolt Fluffy_Pillow 97072.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
4:18.903 default F call_dreadstalkers Fluffy_Pillow 96655.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(3), quick_navigation_final, archive_of_the_titans(20)
4:20.091 default H hand_of_guldan Fluffy_Pillow 97843.0/100000: 98% mana | 4.0/5: 80% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:21.279 build_a_shard K shadow_bolt Fluffy_Pillow 99031.0/100000: 99% mana | 1.0/5: 20% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation_final, overwhelming_power(25), archive_of_the_titans(20)
4:22.662 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(2), dreadstalkers(2), quick_navigation_final, overwhelming_power(24), archive_of_the_titans(20)
4:24.050 default H hand_of_guldan Fluffy_Pillow 97393.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation_final, overwhelming_power(22), archive_of_the_titans(20)
4:25.104 build_a_shard K shadow_bolt Fluffy_Pillow 98447.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation_final, overwhelming_power(21), archive_of_the_titans(20)
4:26.514 build_a_shard K shadow_bolt Fluffy_Pillow 97857.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(20), archive_of_the_titans(20)
4:27.933 build_a_shard K shadow_bolt Fluffy_Pillow 97276.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(6), dreadstalkers(2), overwhelming_power(19), archive_of_the_titans(20)
4:29.454 default H hand_of_guldan Fluffy_Pillow 96797.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(6), dreadstalkers(2), overwhelming_power(17), archive_of_the_titans(20)
4:30.609 build_a_shard K shadow_bolt Fluffy_Pillow 97952.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(3), dreadstalkers(2), overwhelming_power(16), archive_of_the_titans(20)
4:32.156 default I demonbolt Fluffy_Pillow 97499.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core(3), demonic_calling, wild_imps(5), overwhelming_power(14), archive_of_the_titans(20)
4:33.332 default H hand_of_guldan Fluffy_Pillow 96675.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(6), overwhelming_power(13), archive_of_the_titans(20)
4:34.512 default I demonbolt Fluffy_Pillow 97855.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, wild_imps(4), overwhelming_power(12), archive_of_the_titans(20)
4:35.700 default I demonbolt Fluffy_Pillow 97043.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(4), overwhelming_power(11), archive_of_the_titans(20)
4:36.895 build_a_shard K shadow_bolt Fluffy_Pillow 96238.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(6), quick_navigation, overwhelming_power(10), archive_of_the_titans(20)
4:38.486 default H hand_of_guldan Fluffy_Pillow 95829.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(6), quick_navigation, overwhelming_power(8), archive_of_the_titans(20)
4:39.695 default F call_dreadstalkers Fluffy_Pillow 97038.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(5), quick_navigation, overwhelming_power(7), archive_of_the_titans(20)
4:40.911 default I demonbolt Fluffy_Pillow 98254.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation, overwhelming_power(6), archive_of_the_titans(20)
4:42.134 build_a_shard K shadow_bolt Fluffy_Pillow 97477.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation, overwhelming_power(4), archive_of_the_titans(20)
4:43.783 default E summon_vilefiend Fluffy_Pillow 97126.0/100000: 97% mana | 4.0/5: 80% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation, overwhelming_power(3), archive_of_the_titans(20)
4:45.442 default G summon_demonic_tyrant Fluffy_Pillow 98785.0/100000: 99% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power, archive_of_the_titans(20)
4:47.121 default H hand_of_guldan Fluffy_Pillow 98004.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core, demonic_power, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation, archive_of_the_titans(20)
4:48.388 default I demonbolt Fluffy_Pillow 99271.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core, demonic_power, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20)
4:49.648 build_a_shard K shadow_bolt Fluffy_Pillow 98531.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20)
4:51.328 default H hand_of_guldan Fluffy_Pillow 98005.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20)
4:52.581 build_a_shard K shadow_bolt Fluffy_Pillow 99258.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20)
4:54.252 build_a_shard K shadow_bolt Fluffy_Pillow 98006.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20)
4:55.923 build_a_shard K shadow_bolt Fluffy_Pillow 97677.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20)
4:57.584 build_a_shard K shadow_bolt Fluffy_Pillow 97338.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20)
4:59.244 build_a_shard K shadow_bolt Fluffy_Pillow 96998.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 9026 8206 7205
Intellect 1467 -3 8475 7287 5476 (377)
Spirit 0 0 0 0 0
Health 180520 164120 0
Mana 100000 100000 0
Soul Shard 5 5 0
Spell Power 8475 7287 0
Crit 17.68% 17.68% 913
Haste 17.90% 17.90% 1217
Damage / Heal Versatility 1.52% 1.52% 129
ManaReg per Second 1000 1000 0
Mastery 26.55% 26.55% 742
Armor 1159 1159 1159
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Horrific Amalgam's Hood
ilevel: 390, stats: { 154 Armor, +655 Int, +1189 Sta }
azerite powers: { Supreme Commander, Overwhelming Power, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Amice of Corrupting Horror
ilevel: 390, stats: { 142 Armor, +491 Int, +892 Sta }
azerite powers: { Archive of the Titans, Heed My Call, Azerite Empowered }
Local Chest Robes of the Unraveler
ilevel: 390, stats: { 189 Armor, +655 Int, +1189 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Azerite Empowered }
Local Waist Cord of Septic Envelopment
ilevel: 385, stats: { 103 Armor, +247 Int, +417 Sta, +115 Haste, +68 Crit }
Local Legs Leggings of Lingering Infestation
ilevel: 385, stats: { 160 Armor, +329 Int, +556 Sta, +133 Haste, +112 Mastery }
Local Feet Volatile Walkers
ilevel: 385, stats: { 126 Armor, +247 Int, +417 Sta, +111 Crit, +72 Vers }
Local Wrists Void-Lashed Wristband
ilevel: 385, stats: { 80 Armor, +185 Int, +312 Sta, +81 Mastery, +57 Vers }
Local Hands Mutagenic Protofluid Handwraps
ilevel: 385, stats: { 114 Armor, +247 Int, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 370, stats: { +271 Int }
Local Trinket2 Vigilant's Bloodshaper
ilevel: 385, stats: { +313 Int }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Tusk of the Reborn Prophet
ilevel: 385, weapon: { 126 - 211, 1.8 }, stats: { +164 Int, +277 Sta, +70 Crit, +51 Haste, +792 Int }, enchant: quick_navigation
Local Off Hand Codex of Imminent Ruin
ilevel: 385, stats: { +277 Sta, +66 Haste, +56 Mastery, +503 Int }

Talents

Level
15 Dreadlash (Demonology Warlock) Demonic Strength (Demonology Warlock) Bilescourge Bombers (Demonology Warlock)
30 Demonic Calling (Demonology Warlock) Power Siphon (Demonology Warlock) Doom (Demonology Warlock)
45 Demon Skin Burning Rush Dark Pact
60 From the Shadows (Demonology Warlock) Soul Strike (Demonology Warlock) Summon Vilefiend (Demonology Warlock)
75 Darkfury Mortal Coil Demonic Circle
90 Soul Conduit (Demonology Warlock) Inner Demons (Demonology Warlock) Grimoire: Felguard (Demonology Warlock)
100 Sacrificed Souls (Demonology Warlock) Demonic Consumption (Demonology Warlock) Nether Portal (Demonology Warlock)

Profile

warlock="DStr_GF_Imp"
source=default
spec=demonology
level=120
race=troll
role=spell
position=ranged_back
talents=2103033

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/inner_demons,if=talent.inner_demons.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/demonbolt

# Executed every time the actor is available.
actions=potion,if=pet.demonic_tyrant.active|target.time_to_die<30
actions+=/use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
actions+=/demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
actions+=/call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
actions+=/call_action_list,name=implosion,if=spell_targets.implosion>1
actions+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions+=/summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions+=/call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions+=/summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
actions+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
actions+=/doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
actions+=/hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
actions+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
actions+=/bilescourge_bombers
actions+=/call_action_list,name=build_a_shard

actions.build_a_shard=demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
actions.build_a_shard+=/soul_strike
actions.build_a_shard+=/shadow_bolt

actions.implosion=implosion,if=(buff.wild_imps.stack>=6&(soul_shard<3|prev_gcd.1.call_dreadstalkers|buff.wild_imps.stack>=9|prev_gcd.1.bilescourge_bombers|(!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan))&!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan&buff.demonic_power.down)|(time_to_die<3&buff.wild_imps.stack>0)|(prev_gcd.2.call_dreadstalkers&buff.wild_imps.stack>2&!talent.demonic_calling.enabled)
actions.implosion+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.implosion+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.implosion+=/summon_demonic_tyrant
actions.implosion+=/hand_of_guldan,if=soul_shard>=5
actions.implosion+=/hand_of_guldan,if=soul_shard>=3&(((prev_gcd.2.hand_of_guldan|buff.wild_imps.stack>=3)&buff.wild_imps.stack<9)|cooldown.summon_demonic_tyrant.remains<=gcd*2|buff.demonic_power.remains>gcd*2)
actions.implosion+=/demonbolt,if=prev_gcd.1.hand_of_guldan&soul_shard>=1&(buff.wild_imps.stack<=3|prev_gcd.3.hand_of_guldan)&soul_shard<4&buff.demonic_core.up
actions.implosion+=/summon_vilefiend,if=(cooldown.summon_demonic_tyrant.remains>40&spell_targets.implosion<=2)|cooldown.summon_demonic_tyrant.remains<12
actions.implosion+=/bilescourge_bombers,if=cooldown.summon_demonic_tyrant.remains>9
actions.implosion+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions.implosion+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&(buff.demonic_core.stack>=3|buff.demonic_core.remains<=gcd*5.7)
actions.implosion+=/doom,cycle_targets=1,max_cycle_targets=7,if=refreshable
actions.implosion+=/call_action_list,name=build_a_shard

actions.nether_portal=call_action_list,name=nether_portal_building,if=cooldown.nether_portal.remains<20
actions.nether_portal+=/call_action_list,name=nether_portal_active,if=cooldown.nether_portal.remains>160

actions.nether_portal_active=grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.nether_portal_active+=/summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions.nether_portal_active+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.nether_portal_active+=/call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
actions.nether_portal_active+=/hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
actions.nether_portal_active+=/demonbolt,if=buff.demonic_core.up
actions.nether_portal_active+=/call_action_list,name=build_a_shard

actions.nether_portal_building=nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
actions.nether_portal_building+=/call_dreadstalkers
actions.nether_portal_building+=/hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
actions.nether_portal_building+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
actions.nether_portal_building+=/hand_of_guldan,if=soul_shard>=5
actions.nether_portal_building+=/call_action_list,name=build_a_shard

head=horrific_amalgams_hood,id=160616,bonus_id=4824/1507/4775,azerite_powers=458/30/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536,azerite_level=33
shoulders=amice_of_corrupting_horror,id=160726,bonus_id=4824/1507/4775,azerite_powers=483/22/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=robes_of_the_unraveler,id=160614,bonus_id=4824/1507/4775,azerite_powers=483/30/13
wrists=voidlashed_wristband,id=160617,bonus_id=4800/1507
hands=mutagenic_protofluid_handwraps,id=160715,bonus_id=4800/1507
waist=cord_of_septic_envelopment,id=160727,bonus_id=4800/1507
legs=leggings_of_lingering_infestation,id=160615,bonus_id=4800/1507
feet=volatile_walkers,id=160714,bonus_id=4800/1507
finger1=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=ignition_mages_fuse,id=159615,bonus_id=1542/4779
trinket2=vigilants_bloodshaper,id=160651,bonus_id=4800/1507
main_hand=tusk_of_the_reborn_prophet,id=160691,bonus_id=4800/1507,enchant=quick_navigation
off_hand=codex_of_imminent_ruin,id=160696,bonus_id=4800/1507

# Gear Summary
# gear_ilvl=385.25
# gear_stamina=7205
# gear_intellect=5476
# gear_crit_rating=913
# gear_haste_rating=1217
# gear_mastery_rating=742
# gear_versatility_rating=129
# gear_armor=1159
default_pet=Imp

DStr_ID_Felguard : 16988 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
16987.7 16987.7 15.1 / 0.089% 2130.8 / 12.5% 4.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
948.0 939.5 Mana 0.00% 47.6 100.0% 100%
Talents
  • 15: Demonic Strength (Demonology Warlock)
  • 30: Demonic Calling (Demonology Warlock)
  • 60: Summon Vilefiend (Demonology Warlock)
  • 90: Inner Demons (Demonology Warlock)
  • 100: Nether Portal (Demonology Warlock)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
DStr_ID_Felguard 16988
Demonbolt 1314 7.8% 46.3 5.90sec 8516 7494 Direct 47.1 7110 14217 8366 17.7%  

Stats details: demonbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.29 47.12 0.00 0.00 1.1364 0.0000 394181.46 394181.46 0.00 7493.80 7493.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.78 82.32% 7109.53 6520 8308 7111.10 6898 7312 275739 275739 0.00
crit 8.33 17.68% 14216.94 13040 16616 14213.00 0 16616 118443 118443 0.00
 
 

Action details: demonbolt

Static Values
  • id:264178
  • school:shadowflame
  • resource:mana
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:264178
  • name:Demonbolt
  • school:shadowflame
  • tooltip:
  • description:Send the fiery soul of a fallen demon at the enemy, causing {$s1=0} Shadowflame damage.$?c2[ |cFFFFFFFFGenerates 2 Soul Shards.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.667000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Hand of Gul'dan 1072 6.3% 61.7 4.80sec 5214 4735 Direct 61.5 4436 8893 5225 17.7%  

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.67 61.54 0.00 0.00 1.1012 0.0000 321541.77 321541.77 0.00 4734.89 4734.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.65 82.30% 4435.61 1634 5979 4429.53 4041 4820 224649 224649 0.00
crit 10.90 17.70% 8892.95 3267 11958 8882.37 0 10970 96893 96893 0.00
 
 

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadowflame
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.7000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:2.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadowflame
  • tooltip:
  • description:Calls down a demonic meteor full of Wild Imps which burst forth to attack the target. Deals up to ${$m1*$86040m1} Shadowflame damage on impact to all enemies within $86040A1 yds of the target{$?s196283=false}[, applies Doom to each target,][] and summons up to ${$m1*{$104317m2=0}} Wild Imps, based on Soul Shards consumed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.160000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Heed My Call 141 (202) 0.8% (1.2%) 7.3 36.54sec 8270 0 Direct 7.3 4925 9849 5789 17.6%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.31 7.31 0.00 0.00 0.0000 0.0000 42327.70 42327.70 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.03 82.45% 4924.62 4925 4925 4921.67 0 4925 29687 29687 0.00
crit 1.28 17.55% 9849.24 9849 9849 7220.94 0 9849 12641 12641 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4620.00
  • base_dd_max:4620.00
 
    Heed My Call (_aoe) 60 0.4% 7.3 36.54sec 2481 0 Direct 7.3 2111 4221 2481 17.5%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.31 7.31 0.00 0.00 0.0000 0.0000 18139.18 18139.18 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.03 82.45% 2110.55 2111 2111 2108.44 0 2111 12724 12724 0.00
crit 1.28 17.55% 4221.10 4221 4221 3100.60 0 4221 5415 5415 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1980.00
  • base_dd_max:1980.00
 
Shadow Bolt 1278 7.5% 91.3 3.21sec 4195 2811 Direct 90.7 3590 7179 4225 17.7%  

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.33 90.69 0.00 0.00 1.4923 0.0000 383139.50 383139.50 0.00 2811.13 2811.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.65 82.32% 3590.27 3335 4297 3590.83 3539 3655 268005 268005 0.00
crit 16.04 17.68% 7179.02 6670 8595 7179.73 6907 7543 115134 115134 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=0} Shadow damage.$?c2[ |cFFFFFFFFGenerates 1 Soul Shard.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.345000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Volatile Blood Explosion 291 1.7% 7.3 36.64sec 11887 0 Direct 7.2 10240 20481 12051 17.7%  

Stats details: volatile_blood_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.34 7.24 0.00 0.00 0.0000 0.0000 87218.89 87218.89 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.96 82.32% 10240.44 10240 10240 10236.34 0 10240 61015 61015 0.00
crit 1.28 17.68% 20480.88 20481 20481 14941.74 0 20481 26204 26204 0.00
 
 

Action details: volatile_blood_explosion

Static Values
  • id:278057
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278057
  • name:Volatile Blood Explosion
  • school:shadow
  • tooltip:
  • description:Your damaging spells have a chance to launch an orb of charged blood at your target, dealing {$s1=4788} Shadow damage split among all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9607.38
  • base_dd_max:9607.38
 
pet - felguard 3245 / 3245
(demonic_strength_) Felstorm 795 4.7% 5.4 60.69sec 43850 11438 Periodic 32.4 6262 12512 7353 17.5% 6.9%

Stats details: demonic_strength_felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.43 0.00 32.36 32.36 3.8338 0.6429 237944.97 340170.91 30.05 11438.01 11438.01
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.7 82.54% 6261.74 5816 7641 6259.04 6042 6600 167247 239099 30.05
crit 5.7 17.46% 12511.98 11633 15282 12492.57 0 14554 70698 101072 30.02
 
 

Action details: demonic_strength_felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $ Physical damage every $t1 sec. Unable to use other abilities.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc89751=The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Felstorm 368 2.2% 10.2 30.58sec 10842 2864 Periodic 60.6 1545 3092 1819 17.7% 12.8%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.17 0.00 60.62 60.62 3.7857 0.6351 110251.16 157617.28 30.05 2863.89 2863.89
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.9 82.30% 1545.19 1428 1910 1545.17 1517 1587 77087 110206 30.05
crit 10.7 17.70% 3091.66 2856 3820 3091.28 2942 3377 33164 47412 30.05
 
 

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $ Physical damage every $t1 sec. Unable to use other abilities.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc89751=The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Legion Strike 969 5.7% 53.2 5.53sec 5456 5432 Direct 53.2 4633 9268 5456 17.8%  

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.23 53.23 0.00 0.00 1.0045 0.0000 290446.75 415228.51 30.05 5431.75 5431.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.78 82.25% 4633.45 4179 5592 4634.39 4526 4783 202866 290021 30.05
crit 9.45 17.75% 9268.36 8359 11183 9264.81 0 10590 87581 125207 30.04
 
 

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy>=100
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w2%.
  • description:A strong attack that deals $<damage> damage to all enemies in front of it, and reduces the effectiveness of any healing the victim receives by {$s2=10}% for {$d=6 seconds}. |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1113 6.6% 161.2 1.82sec 2070 1404 Direct 161.2 1759 3517 2070 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 161.15 161.15 0.00 0.00 1.4746 0.0000 333608.40 476933.27 30.05 1403.91 1403.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 132.64 82.31% 1759.01 1586 2122 1759.39 1730 1792 233308 333542 30.05
crit 28.52 17.69% 3517.43 3173 4245 3518.36 3335 3799 100300 143391 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - darkhound 1290 / 196
Fel Bite 466 0.4% 10.1 13.64sec 2092 2092 Direct 10.1 1779 3557 2092 17.6%  

Stats details: fel_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.05 10.05 0.00 0.00 1.0001 0.0000 21026.59 30060.03 30.05 2091.78 2091.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.28 82.39% 1778.85 1519 2032 1772.86 0 1983 14732 21061 29.94
crit 1.77 17.61% 3556.59 3037 4064 2750.11 0 4064 6295 8999 23.24
 
 

Action details: fel_bite

Static Values
  • id:272435
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272435
  • name:Fel Bite
  • school:physical
  • tooltip:
  • description:The Darkhound bites its target, causing serious Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 825 0.7% 47.7 2.79sec 776 653 Direct 47.7 659 1319 776 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.68 47.68 0.00 0.00 1.1876 0.0000 37004.63 52902.56 30.05 653.47 653.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.24 82.28% 659.09 562 753 658.43 569 738 25860 36969 30.05
crit 8.45 17.72% 1319.16 1125 1505 1300.67 0 1481 11145 15933 29.65
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - vilefiend 3125 / 1555
Bile Spit 1097 3.2% 6.8 47.21sec 23954 0 Direct 6.8 8827 17662 10396 17.8%  
Periodic 33.3 2779 0 2779 0.0% 22.2%

Stats details: bile_spit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.82 6.80 33.30 33.30 0.0000 2.0000 163254.56 163254.56 0.00 2451.60 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.59 82.24% 8826.61 8474 10104 8826.42 8505 9664 49383 49383 0.00
crit 1.21 17.76% 17661.51 16947 20207 12863.15 0 20207 21339 21339 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.3 100.00% 2779.13 2502 3310 2779.55 2622 2868 92533 92533 0.00
 
 

Action details: bile_spit

Static Values
  • id:267997
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:65.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267997
  • name:Bile Spit
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:The Vilefiend spits a ball of bile at its target, dealing ${$m1*$<demoMastery>} Nature damage and an additional ${$m2*$<demoMastery>} Nature damage every $t2 sec for {$d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.680000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.200000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Headbutt 734 2.2% 30.0 9.82sec 3655 3655 Direct 30.0 3100 6205 3655 17.9%  

Stats details: headbutt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.98 29.98 0.00 0.00 1.0000 0.0000 109582.69 156661.62 30.05 3654.95 3654.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.63 82.13% 3100.16 2737 3621 3100.88 2918 3220 76344 109142 30.05
crit 5.36 17.87% 6204.69 5474 7243 6182.74 0 7243 33239 47519 29.94
 
 

Action details: headbutt

Static Values
  • id:267999
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267999
  • name:Headbutt
  • school:physical
  • tooltip:
  • description:The Vilefiend rams its bladed head into the target, dealing {$s1=0} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1294 3.8% 107.5 2.71sec 1794 1339 Direct 107.5 1525 3049 1794 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.51 107.51 0.00 0.00 1.3398 0.0000 192927.61 275813.18 30.05 1339.32 1339.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.51 82.32% 1524.94 1337 1775 1525.29 1454 1566 134967 192951 30.05
crit 19.01 17.68% 3049.43 2673 3550 3050.06 2818 3303 57961 82862 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - illidari_satyr 1247 / 187
melee 410 0.4% 46.9 2.75sec 388 326 Direct 46.9 329 659 388 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.85 46.85 0.00 0.00 1.1889 0.0000 18172.80 25980.20 30.05 326.26 326.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.55 82.29% 329.48 281 376 329.28 285 372 12702 18159 30.05
crit 8.30 17.71% 659.16 562 753 650.53 0 753 5471 7821 29.68
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 205 0.2% 46.9 2.75sec 194 154 Direct 46.9 165 329 194 17.8%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.85 46.85 0.00 0.00 1.2591 0.0000 9089.05 12993.89 30.05 154.08 154.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.53 82.24% 164.77 141 188 164.66 142 186 6348 9076 30.05
crit 8.32 17.76% 329.32 281 376 324.48 0 376 2741 3918 29.63
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Shadow Slash 633 0.6% 10.1 13.10sec 2795 2795 Direct 10.1 2374 4742 2795 17.8%  

Stats details: shadow_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.10 10.10 0.00 0.00 1.0000 0.0000 28223.44 28223.44 0.00 2794.68 2794.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.31 82.25% 2374.34 2026 2711 2369.50 0 2711 19722 19722 0.00
crit 1.79 17.75% 4741.87 4053 5422 3689.11 0 5422 8501 8501 0.00
 
 

Action details: shadow_slash

Static Values
  • id:272012
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272012
  • name:Shadow Slash
  • school:shadow
  • tooltip:
  • description:The Satyr strikes at out with its weapons, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - dreadstalker 3373 / 2218
Dreadbite 1068 4.1% 28.9 21.06sec 7270 0 Direct 28.9 6176 12357 7270 17.7%  

Stats details: dreadbite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.94 28.94 0.00 0.00 0.0000 0.0000 210362.83 210362.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.81 82.30% 6175.81 5711 7613 6176.18 5974 6383 147074 147074 0.00
crit 5.12 17.70% 12357.41 11423 15227 12298.17 0 15227 63289 63289 0.00
 
 

Action details: dreadbite

Static Values
  • id:205196
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205196
  • name:Dreadbite
  • school:shadow
  • tooltip:
  • description:Bite the target, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 2305 8.9% 311.1 1.90sec 1462 1106 Direct 311.1 1242 2484 1462 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 311.08 311.08 0.00 0.00 1.3215 0.0000 454655.13 649984.11 30.05 1105.95 1105.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 256.13 82.33% 1242.20 1105 1473 1242.37 1225 1260 318160 454848 30.05
crit 54.96 17.67% 2483.62 2211 2947 2483.84 2370 2595 136495 195136 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.83
 
pet - wild_imp 3086 / 3005
Fel Firebolt 3086 17.7% 1201.7 0.24sec 750 508 Direct 1196.8 640 1280 753 17.7%  

Stats details: fel_firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1201.66 1196.81 0.00 0.00 1.4755 0.0000 901025.53 901025.53 0.00 508.18 508.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 985.24 82.32% 639.76 569 761 639.84 630 651 630322 630322 0.00
crit 211.57 17.68% 1279.51 1138 1523 1279.69 1247 1318 270703 270703 0.00
 
 

Action details: fel_firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Fel Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.046000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - demonic_tyrant 4668 / 820
Demonfire 4668 4.8% 37.6 6.88sec 6521 4895 Direct 37.5 5548 11101 6534 17.8%  

Stats details: demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.63 37.55 0.00 0.00 1.3320 0.0000 245349.76 245349.76 0.00 4895.44 4895.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.88 82.24% 5547.86 5029 5917 5551.07 5440 5656 171320 171320 0.00
crit 6.67 17.76% 11101.30 10059 11834 11082.89 0 11834 74030 74030 0.00
 
 

Action details: demonfire

Static Values
  • id:270481
  • school:shadowflame
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:270481
  • name:Demonfire
  • school:shadowflame
  • tooltip:
  • description:Deal {$s1=0} Shadowflame damage to your enemy target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.357500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - void_terror 1802 / 271
Double Breath 0 (147) 0.0% (0.9%) 0.0 0.00sec 0 7321

Stats details: double_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 7321.31 7321.31
 
 

Action details: double_breath

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (1) 489 0.4% 7.8 17.86sec 2787 0 Direct 7.8 2366 4733 2787 17.8%  

Stats details: double_breath1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.84 7.84 0.00 0.00 0.0000 0.0000 21851.83 21851.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.44 82.20% 2365.74 2026 2711 2354.50 0 2711 15246 15246 0.00
crit 1.40 17.80% 4732.82 4053 5422 3372.15 0 5422 6606 6606 0.00
 
 

Action details: double_breath1

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (2) 489 0.4% 7.8 17.86sec 2784 0 Direct 7.8 2366 4730 2784 17.7%  

Stats details: double_breath2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.84 7.84 0.00 0.00 0.0000 0.0000 21827.11 21827.11 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.45 82.32% 2366.02 2026 2711 2356.60 0 2711 15271 15271 0.00
crit 1.39 17.68% 4730.19 4053 5422 3366.06 0 5422 6556 6556 0.00
 
 

Action details: double_breath2

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
melee 825 0.7% 47.3 2.80sec 775 653 Direct 47.3 659 1318 775 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.26 47.26 0.00 0.00 1.1858 0.0000 36624.27 52358.80 30.05 653.48 653.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.96 82.44% 659.11 562 753 658.47 569 744 25680 36712 30.05
crit 8.30 17.56% 1318.37 1125 1505 1301.72 0 1505 10945 15647 29.69
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - wrathguard 1671 / 251
melee 810 0.7% 46.4 2.77sec 774 651 Direct 46.4 659 1318 774 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.40 46.40 0.00 0.00 1.1898 0.0000 35930.01 51366.27 30.05 650.84 650.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.24 82.42% 658.55 562 753 657.47 569 741 25185 36005 30.05
crit 8.16 17.58% 1317.56 1125 1505 1300.93 0 1505 10745 15361 29.72
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 405 0.4% 46.4 2.77sec 387 307 Direct 46.4 329 659 387 17.5%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.40 46.40 0.00 0.00 1.2602 0.0000 17959.74 25675.60 30.05 307.15 307.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.26 82.46% 329.28 281 376 328.71 283 373 12598 18010 30.05
crit 8.14 17.54% 658.79 562 753 649.89 0 741 5362 7666 29.68
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Overhead Assault 456 0.4% 9.8 13.53sec 2087 2087 Direct 9.8 1777 3556 2087 17.4%  

Stats details: overhead_assault

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.77 9.77 0.00 0.00 1.0000 0.0000 20383.71 29140.97 30.05 2087.00 2087.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.07 82.59% 1777.05 1519 2032 1770.99 0 2000 14336 20495 29.96
crit 1.70 17.41% 3556.24 3037 4064 2730.59 0 4064 6048 8646 23.06
 
 

Action details: overhead_assault

Static Values
  • id:272432
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272432
  • name:Overhead Assault
  • school:physical
  • tooltip:
  • description:The Wrathguard smashes its target with a heavy overhand swing.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - urzul 1319 / 201
Many Faced Bite 496 0.4% 10.7 12.20sec 2093 2093 Direct 10.7 1776 3551 2093 17.8%  

Stats details: many_faced_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.68 10.68 0.00 0.00 1.0000 0.0000 22356.61 31961.46 30.05 2093.12 2093.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.78 82.15% 1776.31 1519 2032 1771.93 0 2032 15587 22284 29.98
crit 1.91 17.85% 3551.39 3037 4064 2836.91 0 4064 6769 9678 24.01
 
 

Action details: many_faced_bite

Static Values
  • id:272439
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272439
  • name:Many Faced Bite
  • school:physical
  • tooltip:
  • description:The Ur'zul rears up and bites its target, dealing Physical damage. You're not sure which face actually bit you after thinking about it.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 823 0.7% 47.7 2.66sec 776 653 Direct 47.7 659 1318 776 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.73 47.73 0.00 0.00 1.1892 0.0000 37037.85 52950.05 30.05 652.51 652.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.24 82.21% 658.71 562 753 658.10 570 747 25849 36954 30.05
crit 8.49 17.79% 1317.88 1125 1505 1298.30 0 1505 11189 15996 29.63
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - vicious_hellhound 1048 / 159
Demon Fangs 648 0.6% 10.5 12.93sec 2786 2787 Direct 10.5 2373 4746 2787 17.4%  

Stats details: demon_fangs

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.46 10.46 0.00 0.00 1.0001 0.0000 29144.17 29144.17 0.00 2786.52 2786.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.64 82.58% 2372.93 2026 2711 2369.62 0 2677 20495 20495 0.00
crit 1.82 17.42% 4746.35 4053 5422 3730.88 0 5422 8650 8650 0.00
 
 

Action details: demon_fangs

Static Values
  • id:272013
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272013
  • name:Demon Fangs
  • school:shadowflame
  • tooltip:
  • description:The Vicious Hellhound chomps at its target, dealing Shadowflame damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 400 0.4% 92.1 1.42sec 194 320 Direct 92.1 165 330 194 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.05 92.05 0.00 0.00 0.6078 0.0000 17885.20 25569.05 30.05 319.68 319.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.78 82.32% 165.11 141 188 164.94 142 184 12511 17886 30.05
crit 16.28 17.68% 330.19 281 376 329.43 0 376 5374 7683 30.00
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - bilescourge 3808 / 569
Toxic Bile 3808 3.3% 60.3 2.10sec 2798 2979 Direct 60.3 2380 4758 2800 17.6%  

Stats details: toxic_bile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.32 60.29 0.00 0.00 0.9394 0.0000 168791.75 168791.75 0.00 2979.08 2979.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.65 82.36% 2380.22 2026 2711 2374.31 0 2668 118183 118183 0.00
crit 10.64 17.64% 4757.97 4053 5422 4711.59 0 5422 50609 50609 0.00
 
 

Action details: toxic_bile

Static Values
  • id:272167
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272167
  • name:Toxic Bile
  • school:nature
  • tooltip:
  • description:The Bilescourge spits wads of Toxic Bile at its target, dealing Nature damage.
 
pet - shivarra 1915 / 287
melee 824 0.7% 47.2 2.71sec 775 651 Direct 47.2 659 1317 775 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.23 47.23 0.00 0.00 1.1910 0.0000 36612.82 52342.43 30.05 650.92 650.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.87 82.30% 658.71 562 753 658.27 569 741 25604 36604 30.05
crit 8.36 17.70% 1317.37 1125 1505 1298.56 0 1505 11009 15738 29.65
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 412 0.4% 47.2 2.71sec 388 307 Direct 47.2 329 659 388 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.23 47.23 0.00 0.00 1.2612 0.0000 18303.63 26167.24 30.05 307.29 307.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.88 82.33% 329.34 281 376 329.11 284 369 12805 18306 30.05
crit 8.35 17.67% 658.84 562 753 650.66 0 753 5499 7861 29.69
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Multi-Slash 0 (102) 0.0% (0.6%) 0.0 0.00sec 0 3929

Stats details: multislash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 3929.06 3929.06
 
 

Action details: multislash

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (1) 170 0.1% 7.7 17.71sec 982 0 Direct 7.7 835 1670 982 17.6%  

Stats details: multislash1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.71 7.71 0.00 0.00 0.0000 0.0000 7568.37 10819.89 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.35 82.39% 834.61 717 959 830.63 0 959 5301 7578 29.90
crit 1.36 17.61% 1670.40 1434 1919 1182.38 0 1919 2268 3242 21.26
 
 

Action details: multislash1

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (2) 170 0.1% 7.7 17.71sec 983 0 Direct 7.7 835 1668 983 17.8%  

Stats details: multislash2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.71 7.71 0.00 0.00 0.0000 0.0000 7576.70 10831.80 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.34 82.24% 834.87 717 959 831.00 0 937 5292 7566 29.91
crit 1.37 17.76% 1668.06 1434 1919 1191.73 0 1919 2284 3266 21.46
 
 

Action details: multislash2

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (3) 170 0.1% 7.7 17.71sec 981 0 Direct 7.7 835 1670 981 17.6%  

Stats details: multislash3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.71 7.71 0.00 0.00 0.0000 0.0000 7565.28 10815.47 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.35 82.44% 834.63 717 959 830.53 0 959 5304 7583 29.91
crit 1.35 17.56% 1670.22 1434 1919 1172.72 0 1919 2261 3233 21.11
 
 

Action details: multislash3

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (4) 170 0.1% 7.7 17.71sec 983 0 Direct 7.7 835 1670 983 17.7%  

Stats details: multislash4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.71 7.71 0.00 0.00 0.0000 0.0000 7574.83 10829.13 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.34 82.29% 834.61 717 959 831.36 0 937 5294 7569 29.94
crit 1.37 17.71% 1670.47 1434 1919 1191.85 0 1919 2280 3260 21.44
 
 

Action details: multislash4

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - eye_of_guldan 983 / 82
Eye of Gul'dan 983 0.5% 28.0 5.50sec 866 1138 Periodic 60.9 399 0 399 0.0% 59.6%

Stats details: eye_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.04 0.00 60.89 60.89 0.7613 2.9378 24287.64 24287.64 0.00 121.30 1137.54
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.9 100.00% 398.90 25 484 397.52 353 430 24288 24288 0.00
 
 

Action details: eye_of_guldan

Static Values
  • id:272131
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272131
  • name:Eye of Gul'dan
  • school:shadowflame
  • tooltip:Suffering Shadow damage every $t1 sec.
  • description:The Eye of Gul'dan stares deep into the target's soul, causing Shadow Damage every $t1 sec for {$d=15 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.300000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - prince_malchezaar 4544 / 396
melee 3024 1.5% 21.5 1.75sec 3664 3075 Direct 21.5 3125 6238 3664 17.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.48 21.48 0.00 0.00 1.1916 0.0000 78697.59 112507.65 30.05 3075.21 3075.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.75 82.66% 3124.56 2665 3566 3117.52 2697 3502 55466 79296 30.05
crit 3.72 17.34% 6237.83 5330 7131 5918.12 0 7131 23231 33212 28.50
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 1521 0.8% 21.5 1.75sec 1840 1458 Direct 21.5 1562 3119 1840 17.8%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.48 21.48 0.00 0.00 1.2620 0.0000 39510.08 56484.40 30.05 1457.78 1457.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.65 82.18% 1562.26 1333 1783 1558.81 1349 1746 27572 39417 30.05
crit 3.83 17.82% 3119.28 2665 3566 3023.62 0 3566 11938 17067 29.19
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
DStr_ID_Felguard
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_ID_Felguard
  • harmful:false
  • if_expr:
 
Berserking 2.0 186.88sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:pet.demonic_tyrant.active|target.time_to_die<=15
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Call Dreadstalkers 14.5 21.06sec

Stats details: call_dreadstalkers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.52 0.00 0.00 0.00 1.2049 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: call_dreadstalkers

Static Values
  • id:104316
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:20.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
Spelldata
  • id:104316
  • name:Call Dreadstalkers
  • school:shadow
  • tooltip:
  • description:Summons {$s1=2} ferocious Dreadstalkers to attack the target for {$193332d=12 seconds}.
 
Demonic Strength 5.5 60.47sec

Stats details: demonic_strength

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.47 0.00 0.00 0.00 1.2157 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: demonic_strength

Static Values
  • id:267171
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
Spelldata
  • id:267171
  • name:Demonic Strength
  • school:shadow
  • tooltip:Your next Felstorm will deal {$s2=400}% increased damage.
  • description:Infuse your Felguard with demonic strength and command it to charge your target and unleash a Felstorm that will deal {$s2=400}% increased damage.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_ID_Felguard
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_ID_Felguard
  • harmful:false
  • if_expr:
 
inner_demons 1.0 0.00sec

Stats details: inner_demons

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: inner_demons

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.inner_demons.enabled
 
Nether Portal 2.0 183.53sec

Stats details: nether_portal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.0916 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: nether_portal

Static Values
  • id:267217
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Spelldata
  • id:267217
  • name:Nether Portal
  • school:shadow
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Summon Demonic Tyrant 3.6 93.53sec

Stats details: summon_demonic_tyrant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.57 0.00 0.00 0.00 1.5065 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_demonic_tyrant

Static Values
  • id:265187
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
Spelldata
  • id:265187
  • name:Summon Demonic Tyrant
  • school:shadow
  • tooltip:
  • description:Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.
 
Summon Felguard 1.0 0.00sec

Stats details: summon_felguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_felguard

Static Values
  • id:30146
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:30146
  • name:Summon Felguard
  • school:shadow
  • tooltip:
  • description:Summons a Felguard under your command as a powerful melee combatant.
 
summon_random_demon 17.9 13.89sec

Stats details: summon_random_demon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.85 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_random_demon

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
 
Summon Vilefiend 6.8 47.21sec

Stats details: summon_vilefiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.82 0.00 0.00 0.00 1.5514 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_vilefiend

Static Values
  • id:264119
  • school:fire
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Spelldata
  • id:264119
  • name:Summon Vilefiend
  • school:fire
  • tooltip:
  • description:Summon a Vilefiend to fight for you for the next {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:28.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=7}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 101.9sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 186.9sec 186.9sec 6.76% 8.41% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Demonic Calling 12.7 15.1 23.4sec 10.4sec 51.64% 83.18% 15.1(15.1) 0.1

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_calling_1:51.64%

Trigger Attempt Success

  • trigger_pct:20.01%

Spelldata details

  • id:205146
  • name:Demonic Calling
  • tooltip:Your next Call Dreadstalkers costs {$205145s1=1} less Soul Shard and has no cast time.
  • description:{$@spelldesc205145=Shadow Bolt{$?s264178=true}[ and Demonbolt have][ has] a {$h=20}% chance to make your next Call Dreadstalkers cost {$s1=1} less Soul Shard and have no cast time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Demonic Core 23.8 32.3 12.0sec 5.0sec 41.20% 100.00% 5.1(5.1) 0.4

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_demonic_core
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_core_1:16.69%
  • demonic_core_2:16.19%
  • demonic_core_3:5.62%
  • demonic_core_4:2.70%

Trigger Attempt Success

  • trigger_pct:23.73%

Spelldata details

  • id:264173
  • name:Demonic Core
  • tooltip:The cast time of Demonbolt is reduced by {$s1=100}%.
  • description:{$@spelldesc267102=When your Wild Imps expend all of their energy or are imploded, you have a {$s1=10}% chance to absorb their life essence, granting you a stack of Demonic Core. When your summoned Dreadstalkers fade away, you have a {$s2=100}% chance to absorb their life essence, granting you a stack of Demonic Core. Demonic Core reduces the cast time of Demonbolt by {$264173s1=100}%. Maximum {$264173u=4} stacks.}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Demonic Power 3.6 0.0 93.5sec 93.5sec 17.58% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_demonic_power
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_power_1:17.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:265273
  • name:Demonic Power
  • tooltip:Damage dealt by your demons increased by {$s2=15}%.
  • description:{$@spelldesc265187=Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
dreadstalkers 11.5 17.5 26.8sec 10.2sec 65.76% 0.00% 0.0(0.0) 10.9

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_dreadstalkers
  • max_stacks:4
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • dreadstalkers_2:59.41%
  • dreadstalkers_4:6.35%

Trigger Attempt Success

  • trigger_pct:100.00%
eyes_of_guldan 0.2 0.5 171.9sec 2.7sec 1.37% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_eyes_of_guldan
  • max_stacks:4
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • eyes_of_guldan_4:1.38%

Trigger Attempt Success

  • trigger_pct:100.00%
Ignition Mage's Fuse 2.4 0.0 171.8sec 171.8sec 14.79% 0.00% 2.0(2.0) 2.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:275.80

Stack Uptimes

  • ignition_mages_fuse_1:3.11%
  • ignition_mages_fuse_2:3.07%
  • ignition_mages_fuse_3:3.03%
  • ignition_mages_fuse_4:2.87%
  • ignition_mages_fuse_5:2.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Nether Portal 2.0 0.0 183.6sec 183.6sec 10.14% 18.35% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_nether_portal
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • nether_portal_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267217
  • name:Nether Portal
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Overwhelming Power 4.3 2.9 66.7sec 36.6sec 44.06% 0.00% 2.9(40.8) 0.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • overwhelming_power_1:1.30%
  • overwhelming_power_2:1.34%
  • overwhelming_power_3:1.37%
  • overwhelming_power_4:1.41%
  • overwhelming_power_5:1.44%
  • overwhelming_power_6:1.48%
  • overwhelming_power_7:1.52%
  • overwhelming_power_8:1.55%
  • overwhelming_power_9:1.60%
  • overwhelming_power_10:1.64%
  • overwhelming_power_11:1.69%
  • overwhelming_power_12:1.73%
  • overwhelming_power_13:1.78%
  • overwhelming_power_14:1.82%
  • overwhelming_power_15:1.87%
  • overwhelming_power_16:1.92%
  • overwhelming_power_17:1.97%
  • overwhelming_power_18:2.02%
  • overwhelming_power_19:2.08%
  • overwhelming_power_20:2.14%
  • overwhelming_power_21:2.20%
  • overwhelming_power_22:2.27%
  • overwhelming_power_23:2.34%
  • overwhelming_power_24:2.40%
  • overwhelming_power_25:1.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
portal_summons 2.0 13.4 183.6sec 13.7sec 19.48% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_portal_summons
  • max_stacks:40
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • portal_summons_1:1.61%
  • portal_summons_2:0.78%
  • portal_summons_3:1.21%
  • portal_summons_4:1.52%
  • portal_summons_5:1.88%
  • portal_summons_6:1.83%
  • portal_summons_7:3.89%
  • portal_summons_8:5.66%
  • portal_summons_9:1.10%

Trigger Attempt Success

  • trigger_pct:100.00%
prince_malchezaar 0.2 0.0 164.7sec 110.5sec 1.51% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_prince_malchezaar
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • prince_malchezaar_1:1.52%

Trigger Attempt Success

  • trigger_pct:100.00%
Quick Navigation 6.0 22.4 52.2sec 10.3sec 67.52% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:17.64%
  • quick_navigation_2:17.10%
  • quick_navigation_3:16.69%
  • quick_navigation_4:16.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.4 0.0 52.3sec 52.3sec 17.52% 0.00% 0.0(0.0) 5.2

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:17.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Supreme Commander 4.3 0.1 82.5sec 79.7sec 16.98% 0.00% 0.1(0.1) 3.3

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_supreme_commander
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:838.00

Stack Uptimes

  • supreme_commander_1:16.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279878
  • name:Supreme Commander
  • tooltip:
  • description:When your Demonic Tyrant expires, consume its life essence, granting you a stack of Demonic Core and increasing your Intellect by {$s1=398} for {$279885d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tyrant 3.6 0.0 93.5sec 93.5sec 17.58% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_tyrant
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • tyrant_1:17.58%

Trigger Attempt Success

  • trigger_pct:100.00%
vilefiend 6.8 0.0 47.2sec 47.2sec 49.80% 0.00% 0.0(0.0) 6.3

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_vilefiend
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vilefiend_1:49.80%

Trigger Attempt Success

  • trigger_pct:100.00%
wild_imps 2.0 184.1 131.7sec 0.0sec 97.39% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_wild_imps
  • max_stacks:40
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • wild_imps_1:1.84%
  • wild_imps_2:2.07%
  • wild_imps_3:10.89%
  • wild_imps_4:20.97%
  • wild_imps_5:8.01%
  • wild_imps_6:14.90%
  • wild_imps_7:17.73%
  • wild_imps_8:5.14%
  • wild_imps_9:3.25%
  • wild_imps_10:3.32%
  • wild_imps_11:4.31%
  • wild_imps_12:1.87%
  • wild_imps_13:1.24%
  • wild_imps_14:1.26%
  • wild_imps_15:0.38%
  • wild_imps_16:0.14%
  • wild_imps_17:0.06%
  • wild_imps_18:0.01%
  • wild_imps_19:0.00%
  • wild_imps_20:0.00%
  • wild_imps_21:0.00%
felguard: Demonic Strength 5.5 0.0 60.4sec 60.5sec 10.77% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_ID_Felguard_felguard
  • cooldown name:buff_demonic_strength
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_strength_1:10.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267171
  • name:Demonic Strength
  • tooltip:Your next Felstorm will deal {$s2=400}% increased damage.
  • description:Infuse your Felguard with demonic strength and command it to charge your target and unleash a Felstorm that will deal {$s2=400}% increased damage.
  • max_stacks:0
  • duration:20.00
  • cooldown:60.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Inner Demons

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_inner_demons
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:12.00

Stack Uptimes

  • inner_demons_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267216
  • name:Inner Demons
  • tooltip:
  • description:You passively summon a Wild Imp to fight for you every $t1 sec, and have a {$s1=10}% chance to also summon an additional Demon to fight for you for {$s2=15} sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
summon_random_demon 17.9 13.9sec
one_shard_hog 9.3 21.8sec
two_shard_hog 4.1 51.1sec
three_shard_hog 48.3 5.8sec
portal_summon 15.4 13.7sec

Resources

Resource Usage Type Count Total Average RPE APR
DStr_ID_Felguard
call_dreadstalkers Soul Shard 14.5 17.0 1.2 1.2 0.0
demonbolt Mana 47.3 94579.7 2000.0 2043.3 4.2
hand_of_guldan Soul Shard 61.7 162.4 2.6 2.6 1980.2
shadow_bolt Mana 91.3 182663.6 2000.0 2000.0 2.1
summon_demonic_tyrant Mana 3.6 7143.7 2000.0 2000.2 0.0
summon_vilefiend Soul Shard 6.8 6.8 1.0 1.0 0.0
pet - felguard
demonic_strength_felstorm Energy 5.4 325.6 60.0 60.0 730.9
felstorm Energy 10.2 610.1 60.0 60.0 180.7
legion_strike Energy 53.2 3194.0 60.0 60.0 90.9
pet - wild_imp
fel_firebolt Energy 1201.7 18238.2 15.2 15.2 49.4
Resource Gains Type Count Total Average Overflow
demonbolt Soul Shard 47.29 94.44 (50.84%) 2.00 0.14 0.15%
shadow_bolt Soul Shard 91.33 91.33 (49.16%) 1.00 0.00 0.00%
mana_regen Mana 554.47 281836.48 (100.00%) 508.30 17608.76 5.88%
pet - felguard
energy_regen Energy 378.85 3989.61 (100.00%) 10.53 18.58 0.46%
pet - demonic_tyrant
energy_regen Energy 37.63 0.00 (0.00%) 0.00 759.43 100.00%
pet - bilescourge
energy_regen Energy 14.86 0.00 (0.00%) 0.00 205.32 100.00%
pet - bilescourge
energy_regen Energy 11.25 0.00 (0.00%) 0.00 155.46 100.00%
pet - bilescourge
energy_regen Energy 14.59 0.00 (0.00%) 0.00 201.16 100.00%
pet - bilescourge
energy_regen Energy 10.42 0.00 (0.00%) 0.00 142.70 100.00%
pet - bilescourge
energy_regen Energy 8.10 0.00 (0.00%) 0.00 111.76 100.00%
Resource RPS-Gain RPS-Loss
Mana 939.50 948.00
Soul Shard 0.62 0.62
Combat End Resource Mean Min Max
Mana 97412.95 94078.00 100000.00
Soul Shard 2.59 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 3.5%

Statistics & Data Analysis

Fight Length
Sample Data T22_Warlock_Demonology Fight Length
Count 4999
Mean 299.99
Minimum 240.01
Maximum 359.96
Spread ( max - min ) 119.95
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data T22_Warlock_Demonology Damage Per Second
Count 4999
Mean 16987.68
Minimum 15541.99
Maximum 19151.75
Spread ( max - min ) 3609.76
Range [ ( max - min ) / 2 * 100% ] 10.62%
Standard Deviation 545.4504
5th Percentile 16167.43
95th Percentile 17948.26
( 95th Percentile - 5th Percentile ) 1780.83
Mean Distribution
Standard Deviation 7.7146
95.00% Confidence Intervall ( 16972.56 - 17002.80 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3961
0.1 Scale Factor Error with Delta=300 2540
0.05 Scale Factor Error with Delta=300 10160
0.01 Scale Factor Error with Delta=300 253977
Priority Target DPS
Sample Data T22_Warlock_Demonology Priority Target Damage Per Second
Count 4999
Mean 16987.68
Minimum 15541.99
Maximum 19151.75
Spread ( max - min ) 3609.76
Range [ ( max - min ) / 2 * 100% ] 10.62%
Standard Deviation 545.4504
5th Percentile 16167.43
95th Percentile 17948.26
( 95th Percentile - 5th Percentile ) 1780.83
Mean Distribution
Standard Deviation 7.7146
95.00% Confidence Intervall ( 16972.56 - 17002.80 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3961
0.1 Scale Factor Error with Delta=300 2540
0.05 Scale Factor Error with Delta=300 10160
0.01 Scale Factor Error with Delta=300 253977
DPS(e)
Sample Data T22_Warlock_Demonology Damage Per Second (Effective)
Count 4999
Mean 16987.68
Minimum 15541.99
Maximum 19151.75
Spread ( max - min ) 3609.76
Range [ ( max - min ) / 2 * 100% ] 10.62%
Damage
Sample Data T22_Warlock_Demonology Damage
Count 4999
Mean 1246548.50
Minimum 911456.83
Maximum 1702732.78
Spread ( max - min ) 791275.95
Range [ ( max - min ) / 2 * 100% ] 31.74%
DTPS
Sample Data T22_Warlock_Demonology Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T22_Warlock_Demonology Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T22_Warlock_Demonology Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T22_Warlock_Demonology Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T22_Warlock_Demonology Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T22_Warlock_Demonology Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data T22_Warlock_DemonologyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T22_Warlock_Demonology Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 inner_demons,if=talent.inner_demons.enabled
5 0.00 snapshot_stats
6 0.00 potion
7 0.00 demonbolt
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,if=pet.demonic_tyrant.active|target.time_to_die<30
9 2.36 use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
A 2.00 berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
B 5.47 demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
C 0.00 call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
D 0.00 call_action_list,name=implosion,if=spell_targets.implosion>1
0.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
E 4.84 summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
F 11.52 call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
G 1.59 summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
0.00 doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
H 44.95 hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
0.00 soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
I 42.42 demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
0.00 bilescourge_bombers
J 0.00 call_action_list,name=build_a_shard
actions.build_a_shard
# count action,conditions
0.00 demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
0.00 soul_strike
K 91.81 shadow_bolt
actions.nether_portal_active
# count action,conditions
0.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
O 2.00 summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
P 2.00 call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
Q 0.00 call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
R 14.59 hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
S 1.97 summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
T 0.03 summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
U 3.87 demonbolt,if=buff.demonic_core.up
V 0.00 call_action_list,name=build_a_shard
actions.nether_portal_building
# count action,conditions
W 2.00 nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
X 1.02 call_dreadstalkers
Y 0.54 hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
Z 1.81 hand_of_guldan,if=soul_shard>=5
a 0.00 call_action_list,name=build_a_shard

Sample Sequence

0123467BWOPRKRS9AKRKRKRKRKRKRKKKKFIHKKHKIHIKHKIHIIHIIHIFIEHIHKIHKBIHIKFKHKKKHKKIHKKKKHFIIHEKG8KHKKKKFHKKIHIBHIIHIIHKFKHKKKIHEIHIIKHFKKHIKKKZKKKZKKXYKKKBKKWRRUORS9AUPRURURKRKKKHIIHIKKFHIHKKKHKIHIIKHKEFKBKHKKKHIIHKKKFHKKKHKKKHKIIHIKFKEHGKKHKKKKK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask DStr_ID_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food DStr_ID_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 augmentation DStr_ID_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_felguard Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 4 inner_demons Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 potion Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard battle_potion_of_intellect
0:00.000 precombat 7 demonbolt Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard battle_potion_of_intellect
0:00.000 default B demonic_strength Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard archive_of_the_titans, battle_potion_of_intellect
0:01.277 nether_portal_building W nether_portal Fluffy_Pillow 99277.0/100000: 99% mana | 5.0/5: 100% soul_shard bloodlust, archive_of_the_titans, battle_potion_of_intellect
0:02.257 nether_portal_active O summon_vilefiend Fluffy_Pillow 100000.0/100000: 100% mana | 5.0/5: 100% soul_shard bloodlust, nether_portal, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:03.565 nether_portal_active P call_dreadstalkers Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, nether_portal, vilefiend, portal_summons(2), quick_navigation, archive_of_the_titans, battle_potion_of_intellect
0:04.865 nether_portal_active R hand_of_guldan Fluffy_Pillow 100000.0/100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, portal_summons(3), quick_navigation, archive_of_the_titans, battle_potion_of_intellect
0:05.842 build_a_shard K shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:07.142 nether_portal_active R hand_of_guldan Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard bloodlust, nether_portal, wild_imps, dreadstalkers(2), vilefiend, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:08.121 nether_portal_active S summon_demonic_tyrant Fluffy_Pillow 98983.0/100000: 99% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, portal_summons(5), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:09.422 default 9 use_items Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:09.422 default A berserking Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.422 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:10.514 nether_portal_active R hand_of_guldan Fluffy_Pillow 97097.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:11.331 build_a_shard K shadow_bolt Fluffy_Pillow 97914.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:12.420 nether_portal_active R hand_of_guldan Fluffy_Pillow 97003.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:13.237 build_a_shard K shadow_bolt Fluffy_Pillow 97820.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:14.323 nether_portal_active R hand_of_guldan Fluffy_Pillow 96906.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.116 build_a_shard K shadow_bolt Fluffy_Pillow 97699.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.168 nether_portal_active R hand_of_guldan Fluffy_Pillow 96751.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.960 build_a_shard K shadow_bolt Fluffy_Pillow 97543.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:18.014 nether_portal_active R hand_of_guldan Fluffy_Pillow 96597.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(3), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.775 build_a_shard K shadow_bolt Fluffy_Pillow 97358.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(3), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.793 nether_portal_active R hand_of_guldan Fluffy_Pillow 96376.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(3), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:20.671 build_a_shard K shadow_bolt Fluffy_Pillow 97254.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(3), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(3)
0:21.838 build_a_shard K shadow_bolt Fluffy_Pillow 96421.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(3), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.972 build_a_shard K shadow_bolt Fluffy_Pillow 95555.0/100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, demonic_power, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(3), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:24.103 build_a_shard K shadow_bolt Fluffy_Pillow 94686.0/100000: 95% mana | 3.0/5: 60% soul_shard bloodlust, demonic_power, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(3), archive_of_the_titans(5), ignition_mages_fuse(4)
0:25.235 default F call_dreadstalkers Fluffy_Pillow 93818.0/100000: 94% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, portal_summons(8), quick_navigation(4), archive_of_the_titans(6), ignition_mages_fuse(4)
0:26.360 default I demonbolt Fluffy_Pillow 94943.0/100000: 95% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(4), archive_of_the_titans(6), ignition_mages_fuse(5)
0:27.183 default H hand_of_guldan Fluffy_Pillow 93766.0/100000: 94% mana | 4.0/5: 80% soul_shard bloodlust, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(4), archive_of_the_titans(6), ignition_mages_fuse(5)
0:28.005 build_a_shard K shadow_bolt Fluffy_Pillow 94588.0/100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, supreme_commander, wild_imps(10), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(4), archive_of_the_titans(6), ignition_mages_fuse(5)
0:29.098 build_a_shard K shadow_bolt Fluffy_Pillow 93681.0/100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, supreme_commander, wild_imps(7), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(4), archive_of_the_titans(6), ignition_mages_fuse(5)
0:30.193 default H hand_of_guldan Fluffy_Pillow 92776.0/100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, supreme_commander, wild_imps(3), dreadstalkers(4), vilefiend, quick_navigation(4), archive_of_the_titans(7)
0:31.154 build_a_shard K shadow_bolt Fluffy_Pillow 93737.0/100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, supreme_commander, wild_imps(3), dreadstalkers(4), vilefiend, quick_navigation_final, archive_of_the_titans(7)
0:32.372 default I demonbolt Fluffy_Pillow 92955.0/100000: 93% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core(2), supreme_commander, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(7)
0:33.287 default H hand_of_guldan Fluffy_Pillow 91870.0/100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(7)
0:34.201 default I demonbolt Fluffy_Pillow 92784.0/100000: 93% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(25), archive_of_the_titans(7)
0:35.001 build_a_shard K shadow_bolt Fluffy_Pillow 91584.0/100000: 92% mana | 2.0/5: 40% soul_shard bloodlust, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(24), archive_of_the_titans(8)
0:36.070 default H hand_of_guldan Fluffy_Pillow 90653.0/100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(25), archive_of_the_titans(8)
0:36.871 build_a_shard K shadow_bolt Fluffy_Pillow 91454.0/100000: 91% mana | 0.0/5: 0% soul_shard bloodlust, supreme_commander, wild_imps(7), dreadstalkers(2), quick_navigation_final, overwhelming_power(25), archive_of_the_titans(8)
0:37.939 default I demonbolt Fluffy_Pillow 90522.0/100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(24), archive_of_the_titans(8)
0:38.744 default H hand_of_guldan Fluffy_Pillow 89327.0/100000: 89% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core(3), demonic_calling, supreme_commander, wild_imps(6), quick_navigation_final, overwhelming_power(23), archive_of_the_titans(8)
0:39.553 default I demonbolt Fluffy_Pillow 90136.0/100000: 90% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(3), demonic_calling, wild_imps(7), quick_navigation_final, overwhelming_power(22), archive_of_the_titans(8)
0:40.363 default I demonbolt Fluffy_Pillow 88946.0/100000: 89% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core(2), demonic_calling, wild_imps(7), quick_navigation_final, overwhelming_power(21), archive_of_the_titans(9)
0:41.178 default H hand_of_guldan Fluffy_Pillow 87761.0/100000: 88% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(7), overwhelming_power(20), archive_of_the_titans(9)
0:42.314 default I demonbolt Fluffy_Pillow 88897.0/100000: 89% mana | 1.0/5: 20% soul_shard demonic_core(3), demonic_calling, wild_imps(6), quick_navigation, overwhelming_power(19), archive_of_the_titans(9)
0:43.449 default I demonbolt Fluffy_Pillow 88032.0/100000: 88% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(7), quick_navigation, overwhelming_power(18), archive_of_the_titans(9)
0:44.589 default H hand_of_guldan Fluffy_Pillow 87172.0/100000: 87% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(8), quick_navigation, overwhelming_power(17), archive_of_the_titans(9)
0:45.736 default I demonbolt Fluffy_Pillow 88319.0/100000: 88% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation, overwhelming_power(16), archive_of_the_titans(10)
0:46.890 default F call_dreadstalkers Fluffy_Pillow 87473.0/100000: 87% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(7), quick_navigation, overwhelming_power(15), archive_of_the_titans(10)
0:48.050 default I demonbolt Fluffy_Pillow 88633.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(9), dreadstalkers(2), quick_navigation, overwhelming_power(13), archive_of_the_titans(10)
0:49.224 default E summon_vilefiend Fluffy_Pillow 87807.0/100000: 88% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation, overwhelming_power(12), archive_of_the_titans(10)
0:50.798 default H hand_of_guldan Fluffy_Pillow 89381.0/100000: 89% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(11), archive_of_the_titans(11)
0:51.987 default I demonbolt Fluffy_Pillow 90570.0/100000: 91% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(10), archive_of_the_titans(11)
0:53.182 default H hand_of_guldan Fluffy_Pillow 89765.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(8), archive_of_the_titans(11)
0:54.392 build_a_shard K shadow_bolt Fluffy_Pillow 90975.0/100000: 91% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(7), archive_of_the_titans(11)
0:56.011 default I demonbolt Fluffy_Pillow 90594.0/100000: 91% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(5), archive_of_the_titans(12)
0:57.239 default H hand_of_guldan Fluffy_Pillow 89822.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(4), archive_of_the_titans(12)
0:58.476 build_a_shard K shadow_bolt Fluffy_Pillow 91059.0/100000: 91% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(3), archive_of_the_titans(12)
1:00.136 default B demonic_strength Fluffy_Pillow 90719.0/100000: 91% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(9), vilefiend, quick_navigation, overwhelming_power, archive_of_the_titans(13)
1:01.397 default I demonbolt Fluffy_Pillow 91980.0/100000: 92% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(9), vilefiend, quick_navigation, archive_of_the_titans(13)
1:02.667 default H hand_of_guldan Fluffy_Pillow 91250.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(7), vilefiend, quick_navigation, archive_of_the_titans(13)
1:03.936 default I demonbolt Fluffy_Pillow 92519.0/100000: 93% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(6), vilefiend, quick_navigation(2), archive_of_the_titans(13)
1:05.197 build_a_shard K shadow_bolt Fluffy_Pillow 91780.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(5), vilefiend, quick_navigation(2), archive_of_the_titans(14)
1:06.878 default F call_dreadstalkers Fluffy_Pillow 91461.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), quick_navigation(3), archive_of_the_titans(14)
1:08.143 build_a_shard K shadow_bolt Fluffy_Pillow 92726.0/100000: 93% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(14)
1:09.814 default H hand_of_guldan Fluffy_Pillow 92397.0/100000: 92% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(14)
1:11.066 build_a_shard K shadow_bolt Fluffy_Pillow 93649.0/100000: 94% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(15)
1:12.736 build_a_shard K shadow_bolt Fluffy_Pillow 93319.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(15)
1:14.395 build_a_shard K shadow_bolt Fluffy_Pillow 92978.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(15)
1:15.977 default H hand_of_guldan Fluffy_Pillow 92560.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(16)
1:17.165 build_a_shard K shadow_bolt Fluffy_Pillow 93748.0/100000: 94% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(16)
1:18.747 build_a_shard K shadow_bolt Fluffy_Pillow 93330.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(16)
1:20.329 default I demonbolt Fluffy_Pillow 92912.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, wild_imps(5), quick_navigation_final, archive_of_the_titans(17)
1:21.517 default H hand_of_guldan Fluffy_Pillow 92100.0/100000: 92% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation_final, archive_of_the_titans(17)
1:22.704 build_a_shard K shadow_bolt Fluffy_Pillow 93287.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation_final, archive_of_the_titans(17)
1:24.284 build_a_shard K shadow_bolt Fluffy_Pillow 92867.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation_final, archive_of_the_titans(17)
1:25.864 build_a_shard K shadow_bolt Fluffy_Pillow 92447.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(7), archive_of_the_titans(18)
1:27.564 build_a_shard K shadow_bolt Fluffy_Pillow 92147.0/100000: 92% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(4), archive_of_the_titans(18)
1:29.264 default H hand_of_guldan Fluffy_Pillow 91847.0/100000: 92% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(4), archive_of_the_titans(18)
1:30.542 default F call_dreadstalkers Fluffy_Pillow 93125.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(4), archive_of_the_titans(19)
1:31.816 default I demonbolt Fluffy_Pillow 94399.0/100000: 94% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(5), dreadstalkers(2), archive_of_the_titans(19)
1:33.093 default I demonbolt Fluffy_Pillow 93676.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), quick_navigation, archive_of_the_titans(19)
1:34.362 default H hand_of_guldan Fluffy_Pillow 92945.0/100000: 93% mana | 5.0/5: 100% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation, archive_of_the_titans(19)
1:35.631 default E summon_vilefiend Fluffy_Pillow 94214.0/100000: 94% mana | 2.0/5: 40% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
1:37.483 build_a_shard K shadow_bolt Fluffy_Pillow 96066.0/100000: 96% mana | 1.0/5: 20% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(20)
1:39.172 default G summon_demonic_tyrant Fluffy_Pillow 95755.0/100000: 96% mana | 2.0/5: 40% soul_shard wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
1:41.097 default 8 potion Fluffy_Pillow 95680.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20)
1:41.097 build_a_shard K shadow_bolt Fluffy_Pillow 95680.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20), battle_potion_of_intellect
1:42.778 default H hand_of_guldan Fluffy_Pillow 95361.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20), battle_potion_of_intellect
1:44.037 build_a_shard K shadow_bolt Fluffy_Pillow 96620.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:45.707 build_a_shard K shadow_bolt Fluffy_Pillow 96290.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:47.377 build_a_shard K shadow_bolt Fluffy_Pillow 95960.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:49.043 build_a_shard K shadow_bolt Fluffy_Pillow 95626.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:50.713 default F call_dreadstalkers Fluffy_Pillow 95296.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:51.966 default H hand_of_guldan Fluffy_Pillow 96549.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(8), dreadstalkers(4), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:53.217 build_a_shard K shadow_bolt Fluffy_Pillow 97800.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(8), dreadstalkers(4), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:54.884 build_a_shard K shadow_bolt Fluffy_Pillow 97467.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(10), dreadstalkers(4), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:56.554 default I demonbolt Fluffy_Pillow 97137.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:57.806 default H hand_of_guldan Fluffy_Pillow 96389.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:59.060 default I demonbolt Fluffy_Pillow 97643.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
2:00.312 default B demonic_strength Fluffy_Pillow 96895.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
2:01.564 default H hand_of_guldan Fluffy_Pillow 98147.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
2:02.817 default I demonbolt Fluffy_Pillow 99400.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core(4), demonic_calling, supreme_commander, wild_imps(11), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:04.061 default I demonbolt Fluffy_Pillow 98644.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(7), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:05.307 default H hand_of_guldan Fluffy_Pillow 97890.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(7), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:06.553 default I demonbolt Fluffy_Pillow 99136.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(7), vilefiend, quick_navigation(4), archive_of_the_titans(20)
2:07.798 default I demonbolt Fluffy_Pillow 98381.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(8), quick_navigation(4), archive_of_the_titans(20)
2:09.044 default H hand_of_guldan Fluffy_Pillow 97627.0/100000: 98% mana | 5.0/5: 100% soul_shard demonic_calling, supreme_commander, wild_imps(7), quick_navigation(4), archive_of_the_titans(20)
2:10.290 build_a_shard K shadow_bolt Fluffy_Pillow 98873.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_calling, supreme_commander, wild_imps(6), quick_navigation(4), archive_of_the_titans(20)
2:11.950 default F call_dreadstalkers Fluffy_Pillow 98005.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(8), quick_navigation_final, archive_of_the_titans(20)
2:13.137 build_a_shard K shadow_bolt Fluffy_Pillow 99192.0/100000: 99% mana | 2.0/5: 40% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:14.721 default H hand_of_guldan Fluffy_Pillow 98006.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:15.909 build_a_shard K shadow_bolt Fluffy_Pillow 99194.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:17.492 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:19.076 build_a_shard K shadow_bolt Fluffy_Pillow 97589.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:20.659 default I demonbolt Fluffy_Pillow 97172.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:21.845 default H hand_of_guldan Fluffy_Pillow 96358.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:23.033 default E summon_vilefiend Fluffy_Pillow 97546.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
2:24.724 default I demonbolt Fluffy_Pillow 99237.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(6), vilefiend, quick_navigation, archive_of_the_titans(20)
2:25.993 default H hand_of_guldan Fluffy_Pillow 98506.0/100000: 99% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(4), vilefiend, quick_navigation, archive_of_the_titans(20)
2:27.262 default I demonbolt Fluffy_Pillow 99775.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(4), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:28.521 default I demonbolt Fluffy_Pillow 99034.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(5), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:29.779 build_a_shard K shadow_bolt Fluffy_Pillow 98292.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:31.459 default H hand_of_guldan Fluffy_Pillow 97972.0/100000: 98% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(7), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:32.711 default F call_dreadstalkers Fluffy_Pillow 99224.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(5), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:33.963 build_a_shard K shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:35.632 build_a_shard K shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:37.300 default H hand_of_guldan Fluffy_Pillow 97672.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:38.553 default I demonbolt Fluffy_Pillow 98925.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:39.807 build_a_shard K shadow_bolt Fluffy_Pillow 98179.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
2:41.477 build_a_shard K shadow_bolt Fluffy_Pillow 97849.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation(4), overwhelming_power(25), archive_of_the_titans(20)
2:42.918 build_a_shard K shadow_bolt Fluffy_Pillow 97290.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(4), overwhelming_power(24), archive_of_the_titans(20)
2:44.366 nether_portal_building Z hand_of_guldan Fluffy_Pillow 96738.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(4), overwhelming_power(22), archive_of_the_titans(20)
2:45.463 build_a_shard K shadow_bolt Fluffy_Pillow 97835.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(4), overwhelming_power(21), archive_of_the_titans(20)
2:46.934 build_a_shard K shadow_bolt Fluffy_Pillow 97306.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation_final, overwhelming_power(20), archive_of_the_titans(20)
2:48.353 build_a_shard K shadow_bolt Fluffy_Pillow 96725.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, wild_imps(4), quick_navigation_final, overwhelming_power(18), archive_of_the_titans(20)
2:49.787 nether_portal_building Z hand_of_guldan Fluffy_Pillow 96159.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_core(3), demonic_calling, wild_imps(4), quick_navigation_final, overwhelming_power(17), archive_of_the_titans(20)
2:50.870 build_a_shard K shadow_bolt Fluffy_Pillow 97242.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, wild_imps(4), quick_navigation_final, overwhelming_power(16), archive_of_the_titans(20)
2:52.318 build_a_shard K shadow_bolt Fluffy_Pillow 96690.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(3), demonic_calling, wild_imps(5), quick_navigation_final, overwhelming_power(14), archive_of_the_titans(20)
2:53.782 nether_portal_building X call_dreadstalkers Fluffy_Pillow 96154.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, wild_imps(7), quick_navigation_final, overwhelming_power(13), archive_of_the_titans(20)
2:54.887 nether_portal_building Y hand_of_guldan Fluffy_Pillow 97259.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(3), wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(12), archive_of_the_titans(20)
2:55.999 build_a_shard K shadow_bolt Fluffy_Pillow 98371.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(3), wild_imps(3), dreadstalkers(2), quick_navigation_final, overwhelming_power(11), archive_of_the_titans(20)
2:57.487 build_a_shard K shadow_bolt Fluffy_Pillow 97859.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(3), demonic_calling, wild_imps(4), dreadstalkers(2), overwhelming_power(9), archive_of_the_titans(20)
2:59.098 build_a_shard K shadow_bolt Fluffy_Pillow 97470.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation, overwhelming_power(7), archive_of_the_titans(20)
3:00.717 default B demonic_strength Fluffy_Pillow 97089.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(4), demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation, overwhelming_power(6), archive_of_the_titans(20)
3:01.939 build_a_shard K shadow_bolt Fluffy_Pillow 98311.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(4), demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation, overwhelming_power(5), archive_of_the_titans(20)
3:03.579 build_a_shard K shadow_bolt Fluffy_Pillow 97951.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core(4), demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation, overwhelming_power(25), archive_of_the_titans(20)
3:05.043 nether_portal_building W nether_portal Fluffy_Pillow 97415.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(4), demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation, overwhelming_power(23), archive_of_the_titans(20)
3:06.155 nether_portal_active R hand_of_guldan Fluffy_Pillow 98527.0/100000: 99% mana | 5.0/5: 100% soul_shard demonic_core(4), demonic_calling, nether_portal, wild_imps, portal_summons, quick_navigation, overwhelming_power(22), archive_of_the_titans(20)
3:07.272 nether_portal_active R hand_of_guldan Fluffy_Pillow 99644.0/100000: 100% mana | 2.0/5: 40% soul_shard demonic_core(4), demonic_calling, nether_portal, wild_imps, portal_summons(2), quick_navigation, overwhelming_power(21), archive_of_the_titans(20)
3:08.394 nether_portal_active U demonbolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(4), demonic_calling, nether_portal, eyes_of_guldan(4), portal_summons(3), quick_navigation, overwhelming_power(20), archive_of_the_titans(20)
3:09.521 nether_portal_active O summon_vilefiend Fluffy_Pillow 99127.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, nether_portal, wild_imps(3), eyes_of_guldan(4), portal_summons(3), quick_navigation, overwhelming_power(19), archive_of_the_titans(20)
3:11.232 nether_portal_active R hand_of_guldan Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard demonic_core(3), demonic_calling, nether_portal, wild_imps(5), vilefiend, eyes_of_guldan(4), portal_summons(4), quick_navigation, overwhelming_power(17), archive_of_the_titans(20)
3:12.380 nether_portal_active S summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, nether_portal, wild_imps(6), vilefiend, eyes_of_guldan(4), portal_summons(5), quick_navigation, overwhelming_power(16), archive_of_the_titans(20)
3:13.917 default 9 use_items Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_power, demonic_calling, nether_portal, wild_imps(7), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(5), quick_navigation, overwhelming_power(15), archive_of_the_titans(20)
3:13.917 default A berserking Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_power, demonic_calling, nether_portal, wild_imps(7), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(5), quick_navigation, overwhelming_power(15), archive_of_the_titans(20), ignition_mages_fuse
3:13.917 nether_portal_active U demonbolt Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_core(3), demonic_power, demonic_calling, nether_portal, wild_imps(7), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(5), quick_navigation, overwhelming_power(15), archive_of_the_titans(20), ignition_mages_fuse
3:14.897 nether_portal_active P call_dreadstalkers Fluffy_Pillow 96984.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_core(2), demonic_power, demonic_calling, nether_portal, wild_imps(7), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(5), quick_navigation, overwhelming_power(14), archive_of_the_titans(20), ignition_mages_fuse
3:15.881 nether_portal_active R hand_of_guldan Fluffy_Pillow 97968.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_core(2), demonic_power, nether_portal, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(6), quick_navigation, overwhelming_power(13), archive_of_the_titans(20), ignition_mages_fuse
3:16.872 nether_portal_active U demonbolt Fluffy_Pillow 98959.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_core(2), demonic_power, nether_portal, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(7), quick_navigation, overwhelming_power(12), archive_of_the_titans(20), ignition_mages_fuse
3:17.867 nether_portal_active R hand_of_guldan Fluffy_Pillow 97954.0/100000: 98% mana | 2.0/5: 40% soul_shard berserking, demonic_core, demonic_power, nether_portal, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(7), quick_navigation, overwhelming_power(11), archive_of_the_titans(20), ignition_mages_fuse
3:18.869 nether_portal_active U demonbolt Fluffy_Pillow 98956.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_core, demonic_power, nether_portal, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(8), quick_navigation(2), overwhelming_power(10), archive_of_the_titans(20), ignition_mages_fuse(2)
3:19.840 nether_portal_active R hand_of_guldan Fluffy_Pillow 97927.0/100000: 98% mana | 2.0/5: 40% soul_shard berserking, demonic_power, nether_portal, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(8), quick_navigation(2), overwhelming_power(9), archive_of_the_titans(20), ignition_mages_fuse(2)
3:20.815 build_a_shard K shadow_bolt Fluffy_Pillow 98902.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(8), quick_navigation(2), overwhelming_power(8), archive_of_the_titans(20), ignition_mages_fuse(2)
3:22.122 nether_portal_active R hand_of_guldan Fluffy_Pillow 98003.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, demonic_calling, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(8), quick_navigation(2), overwhelming_power(6), archive_of_the_titans(20), ignition_mages_fuse(3)
3:23.085 build_a_shard K shadow_bolt Fluffy_Pillow 98966.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, demonic_calling, wild_imps(12), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(8), quick_navigation(3), overwhelming_power(5), archive_of_the_titans(20), ignition_mages_fuse(3)
3:24.369 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(14), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(8), quick_navigation(4), overwhelming_power(4), archive_of_the_titans(20), ignition_mages_fuse(3)
3:25.844 build_a_shard K shadow_bolt Fluffy_Pillow 97480.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(14), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(8), quick_navigation(4), overwhelming_power(3), archive_of_the_titans(20), ignition_mages_fuse(3)
3:27.328 default H hand_of_guldan Fluffy_Pillow 96964.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_power, demonic_calling, wild_imps(14), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(8), quick_navigation(4), overwhelming_power, archive_of_the_titans(20), ignition_mages_fuse(4)
3:28.419 default I demonbolt Fluffy_Pillow 98055.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_power, demonic_calling, wild_imps(14), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(8), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse(4)
3:29.518 default I demonbolt Fluffy_Pillow 97154.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(15), vilefiend, eyes_of_guldan(4), portal_summons(8), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse(4)
3:30.616 default H hand_of_guldan Fluffy_Pillow 96252.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(17), vilefiend, eyes_of_guldan(4), portal_summons(8), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse(5)
3:31.681 default I demonbolt Fluffy_Pillow 97317.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(14), vilefiend, eyes_of_guldan(4), portal_summons(8), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse(5)
3:32.748 build_a_shard K shadow_bolt Fluffy_Pillow 96384.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_calling, supreme_commander, wild_imps(13), vilefiend, eyes_of_guldan(4), portal_summons(8), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse(5)
3:34.170 build_a_shard K shadow_bolt Fluffy_Pillow 95806.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_calling, supreme_commander, wild_imps(15), vilefiend, eyes_of_guldan(4), quick_navigation(4), archive_of_the_titans(20)
3:35.832 default F call_dreadstalkers Fluffy_Pillow 95468.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_calling, supreme_commander, wild_imps(11), vilefiend, eyes_of_guldan(4), quick_navigation(4), archive_of_the_titans(20)
3:37.078 default H hand_of_guldan Fluffy_Pillow 96714.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, eyes_of_guldan(4), quick_navigation(4), archive_of_the_titans(20)
3:38.323 default I demonbolt Fluffy_Pillow 97959.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, supreme_commander, wild_imps(4), dreadstalkers(2), vilefiend, eyes_of_guldan(4), quick_navigation(4), archive_of_the_titans(20)
3:39.569 default H hand_of_guldan Fluffy_Pillow 97205.0/100000: 97% mana | 3.0/5: 60% soul_shard supreme_commander, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
3:40.816 build_a_shard K shadow_bolt Fluffy_Pillow 98452.0/100000: 98% mana | 0.0/5: 0% soul_shard supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
3:42.399 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
3:43.983 build_a_shard K shadow_bolt Fluffy_Pillow 97589.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
3:45.567 default H hand_of_guldan Fluffy_Pillow 97173.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
3:46.756 build_a_shard K shadow_bolt Fluffy_Pillow 98362.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
3:48.339 default I demonbolt Fluffy_Pillow 97945.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation_final, archive_of_the_titans(20)
3:49.526 default H hand_of_guldan Fluffy_Pillow 97132.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(7), quick_navigation_final, archive_of_the_titans(20)
3:50.714 default I demonbolt Fluffy_Pillow 98320.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation_final, overwhelming_power(25), archive_of_the_titans(20)
3:51.752 default I demonbolt Fluffy_Pillow 97358.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(4), overwhelming_power(24), archive_of_the_titans(20)
3:52.863 build_a_shard K shadow_bolt Fluffy_Pillow 96469.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), overwhelming_power(23), archive_of_the_titans(20)
3:54.352 default H hand_of_guldan Fluffy_Pillow 95958.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(7), overwhelming_power(21), archive_of_the_titans(20)
3:55.482 build_a_shard K shadow_bolt Fluffy_Pillow 97088.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), overwhelming_power(20), archive_of_the_titans(20)
3:56.995 default E summon_vilefiend Fluffy_Pillow 96601.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(5), overwhelming_power(19), archive_of_the_titans(20)
3:58.516 default F call_dreadstalkers Fluffy_Pillow 98122.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), vilefiend, overwhelming_power(17), archive_of_the_titans(20)
3:59.670 build_a_shard K shadow_bolt Fluffy_Pillow 99276.0/100000: 99% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), vilefiend, overwhelming_power(16), archive_of_the_titans(20)
4:01.217 default B demonic_strength Fluffy_Pillow 98005.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, overwhelming_power(14), archive_of_the_titans(20)
4:02.392 build_a_shard K shadow_bolt Fluffy_Pillow 99180.0/100000: 99% mana | 2.0/5: 40% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, overwhelming_power(13), archive_of_the_titans(20)
4:03.966 default H hand_of_guldan Fluffy_Pillow 98005.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(12), archive_of_the_titans(20)
4:05.148 build_a_shard K shadow_bolt Fluffy_Pillow 99187.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps, dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(10), archive_of_the_titans(20)
4:06.729 build_a_shard K shadow_bolt Fluffy_Pillow 98003.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(9), archive_of_the_titans(20)
4:08.321 build_a_shard K shadow_bolt Fluffy_Pillow 97595.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(7), archive_of_the_titans(20)
4:09.930 default H hand_of_guldan Fluffy_Pillow 97204.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(6), archive_of_the_titans(20)
4:11.145 default I demonbolt Fluffy_Pillow 98419.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(3), vilefiend, quick_navigation(2), overwhelming_power(4), archive_of_the_titans(20)
4:12.374 default I demonbolt Fluffy_Pillow 97648.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(5), vilefiend, quick_navigation(2), overwhelming_power(3), archive_of_the_titans(20)
4:13.610 default H hand_of_guldan Fluffy_Pillow 96884.0/100000: 97% mana | 4.0/5: 80% soul_shard wild_imps(7), quick_navigation(2), overwhelming_power(2), archive_of_the_titans(20)
4:14.856 build_a_shard K shadow_bolt Fluffy_Pillow 98130.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(5), quick_navigation(2), overwhelming_power, archive_of_the_titans(20)
4:16.524 build_a_shard K shadow_bolt Fluffy_Pillow 97798.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), quick_navigation(2), overwhelming_power(25), archive_of_the_titans(20)
4:17.980 build_a_shard K shadow_bolt Fluffy_Pillow 97254.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), quick_navigation(2), overwhelming_power(24), archive_of_the_titans(20)
4:19.442 default F call_dreadstalkers Fluffy_Pillow 96716.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), quick_navigation(2), overwhelming_power(22), archive_of_the_titans(20)
4:20.552 default H hand_of_guldan Fluffy_Pillow 97826.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(2), overwhelming_power(21), archive_of_the_titans(20)
4:21.669 build_a_shard K shadow_bolt Fluffy_Pillow 98943.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(3), overwhelming_power(20), archive_of_the_titans(20)
4:23.155 build_a_shard K shadow_bolt Fluffy_Pillow 98003.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation(3), overwhelming_power(18), archive_of_the_titans(20)
4:24.657 build_a_shard K shadow_bolt Fluffy_Pillow 97505.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(3), overwhelming_power(17), archive_of_the_titans(20)
4:26.168 default H hand_of_guldan Fluffy_Pillow 97016.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(3), overwhelming_power(15), archive_of_the_titans(20)
4:27.314 build_a_shard K shadow_bolt Fluffy_Pillow 98162.0/100000: 98% mana | 0.0/5: 0% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(4), overwhelming_power(14), archive_of_the_titans(20)
4:28.843 build_a_shard K shadow_bolt Fluffy_Pillow 97691.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation(4), overwhelming_power(13), archive_of_the_titans(20)
4:30.379 build_a_shard K shadow_bolt Fluffy_Pillow 97227.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(11), archive_of_the_titans(20)
4:31.867 default H hand_of_guldan Fluffy_Pillow 96715.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation_final, overwhelming_power(10), archive_of_the_titans(20)
4:32.990 build_a_shard K shadow_bolt Fluffy_Pillow 97838.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation_final, overwhelming_power(9), archive_of_the_titans(20)
4:34.494 default I demonbolt Fluffy_Pillow 97342.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation_final, overwhelming_power(7), archive_of_the_titans(20)
4:35.636 default I demonbolt Fluffy_Pillow 96484.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(6), quick_navigation_final, overwhelming_power(6), archive_of_the_titans(20)
4:36.785 default H hand_of_guldan Fluffy_Pillow 95633.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(4), quick_navigation_final, overwhelming_power(5), archive_of_the_titans(20)
4:37.938 default I demonbolt Fluffy_Pillow 96786.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(4), quick_navigation_final, overwhelming_power(4), archive_of_the_titans(20)
4:39.099 build_a_shard K shadow_bolt Fluffy_Pillow 95947.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(5), quick_navigation_final, overwhelming_power(2), archive_of_the_titans(20)
4:40.664 default F call_dreadstalkers Fluffy_Pillow 95512.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(7), quick_navigation, overwhelming_power, archive_of_the_titans(20)
4:41.924 build_a_shard K shadow_bolt Fluffy_Pillow 96772.0/100000: 97% mana | 4.0/5: 80% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:43.613 default E summon_vilefiend Fluffy_Pillow 96461.0/100000: 96% mana | 5.0/5: 100% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:45.302 default H hand_of_guldan Fluffy_Pillow 98150.0/100000: 98% mana | 4.0/5: 80% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(20)
4:46.571 default G summon_demonic_tyrant Fluffy_Pillow 99419.0/100000: 99% mana | 1.0/5: 20% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(20)
4:48.262 build_a_shard K shadow_bolt Fluffy_Pillow 98006.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation, archive_of_the_titans(20)
4:49.953 build_a_shard K shadow_bolt Fluffy_Pillow 97697.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation, archive_of_the_titans(20)
4:51.644 default H hand_of_guldan Fluffy_Pillow 97388.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation, archive_of_the_titans(20)
4:52.912 build_a_shard K shadow_bolt Fluffy_Pillow 98656.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation, archive_of_the_titans(20)
4:54.603 build_a_shard K shadow_bolt Fluffy_Pillow 98006.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation, archive_of_the_titans(20)
4:56.291 build_a_shard K shadow_bolt Fluffy_Pillow 97694.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20)
4:57.971 build_a_shard K shadow_bolt Fluffy_Pillow 97374.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20)
4:59.652 build_a_shard K shadow_bolt Fluffy_Pillow 97055.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 9026 8206 7205
Intellect 1467 -3 8475 7287 5476 (377)
Spirit 0 0 0 0 0
Health 180520 164120 0
Mana 100000 100000 0
Soul Shard 5 5 0
Spell Power 8475 7287 0
Crit 17.68% 17.68% 913
Haste 17.90% 17.90% 1217
Damage / Heal Versatility 1.52% 1.52% 129
ManaReg per Second 1000 1000 0
Mastery 26.55% 26.55% 742
Armor 1159 1159 1159
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Horrific Amalgam's Hood
ilevel: 390, stats: { 154 Armor, +655 Int, +1189 Sta }
azerite powers: { Supreme Commander, Overwhelming Power, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Amice of Corrupting Horror
ilevel: 390, stats: { 142 Armor, +491 Int, +892 Sta }
azerite powers: { Archive of the Titans, Heed My Call, Azerite Empowered }
Local Chest Robes of the Unraveler
ilevel: 390, stats: { 189 Armor, +655 Int, +1189 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Azerite Empowered }
Local Waist Cord of Septic Envelopment
ilevel: 385, stats: { 103 Armor, +247 Int, +417 Sta, +115 Haste, +68 Crit }
Local Legs Leggings of Lingering Infestation
ilevel: 385, stats: { 160 Armor, +329 Int, +556 Sta, +133 Haste, +112 Mastery }
Local Feet Volatile Walkers
ilevel: 385, stats: { 126 Armor, +247 Int, +417 Sta, +111 Crit, +72 Vers }
Local Wrists Void-Lashed Wristband
ilevel: 385, stats: { 80 Armor, +185 Int, +312 Sta, +81 Mastery, +57 Vers }
Local Hands Mutagenic Protofluid Handwraps
ilevel: 385, stats: { 114 Armor, +247 Int, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 370, stats: { +271 Int }
Local Trinket2 Vigilant's Bloodshaper
ilevel: 385, stats: { +313 Int }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Tusk of the Reborn Prophet
ilevel: 385, weapon: { 126 - 211, 1.8 }, stats: { +164 Int, +277 Sta, +70 Crit, +51 Haste, +792 Int }, enchant: quick_navigation
Local Off Hand Codex of Imminent Ruin
ilevel: 385, stats: { +277 Sta, +66 Haste, +56 Mastery, +503 Int }

Talents

Level
15 Dreadlash (Demonology Warlock) Demonic Strength (Demonology Warlock) Bilescourge Bombers (Demonology Warlock)
30 Demonic Calling (Demonology Warlock) Power Siphon (Demonology Warlock) Doom (Demonology Warlock)
45 Demon Skin Burning Rush Dark Pact
60 From the Shadows (Demonology Warlock) Soul Strike (Demonology Warlock) Summon Vilefiend (Demonology Warlock)
75 Darkfury Mortal Coil Demonic Circle
90 Soul Conduit (Demonology Warlock) Inner Demons (Demonology Warlock) Grimoire: Felguard (Demonology Warlock)
100 Sacrificed Souls (Demonology Warlock) Demonic Consumption (Demonology Warlock) Nether Portal (Demonology Warlock)

Profile

warlock="DStr_ID_Felguard"
source=default
spec=demonology
level=120
race=troll
role=spell
position=ranged_back
talents=2103023

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/inner_demons,if=talent.inner_demons.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/demonbolt

# Executed every time the actor is available.
actions=potion,if=pet.demonic_tyrant.active|target.time_to_die<30
actions+=/use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
actions+=/demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
actions+=/call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
actions+=/call_action_list,name=implosion,if=spell_targets.implosion>1
actions+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions+=/summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions+=/call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions+=/summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
actions+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
actions+=/doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
actions+=/hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
actions+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
actions+=/bilescourge_bombers
actions+=/call_action_list,name=build_a_shard

actions.build_a_shard=demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
actions.build_a_shard+=/soul_strike
actions.build_a_shard+=/shadow_bolt

actions.implosion=implosion,if=(buff.wild_imps.stack>=6&(soul_shard<3|prev_gcd.1.call_dreadstalkers|buff.wild_imps.stack>=9|prev_gcd.1.bilescourge_bombers|(!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan))&!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan&buff.demonic_power.down)|(time_to_die<3&buff.wild_imps.stack>0)|(prev_gcd.2.call_dreadstalkers&buff.wild_imps.stack>2&!talent.demonic_calling.enabled)
actions.implosion+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.implosion+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.implosion+=/summon_demonic_tyrant
actions.implosion+=/hand_of_guldan,if=soul_shard>=5
actions.implosion+=/hand_of_guldan,if=soul_shard>=3&(((prev_gcd.2.hand_of_guldan|buff.wild_imps.stack>=3)&buff.wild_imps.stack<9)|cooldown.summon_demonic_tyrant.remains<=gcd*2|buff.demonic_power.remains>gcd*2)
actions.implosion+=/demonbolt,if=prev_gcd.1.hand_of_guldan&soul_shard>=1&(buff.wild_imps.stack<=3|prev_gcd.3.hand_of_guldan)&soul_shard<4&buff.demonic_core.up
actions.implosion+=/summon_vilefiend,if=(cooldown.summon_demonic_tyrant.remains>40&spell_targets.implosion<=2)|cooldown.summon_demonic_tyrant.remains<12
actions.implosion+=/bilescourge_bombers,if=cooldown.summon_demonic_tyrant.remains>9
actions.implosion+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions.implosion+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&(buff.demonic_core.stack>=3|buff.demonic_core.remains<=gcd*5.7)
actions.implosion+=/doom,cycle_targets=1,max_cycle_targets=7,if=refreshable
actions.implosion+=/call_action_list,name=build_a_shard

actions.nether_portal=call_action_list,name=nether_portal_building,if=cooldown.nether_portal.remains<20
actions.nether_portal+=/call_action_list,name=nether_portal_active,if=cooldown.nether_portal.remains>160

actions.nether_portal_active=grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.nether_portal_active+=/summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions.nether_portal_active+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.nether_portal_active+=/call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
actions.nether_portal_active+=/hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
actions.nether_portal_active+=/demonbolt,if=buff.demonic_core.up
actions.nether_portal_active+=/call_action_list,name=build_a_shard

actions.nether_portal_building=nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
actions.nether_portal_building+=/call_dreadstalkers
actions.nether_portal_building+=/hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
actions.nether_portal_building+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
actions.nether_portal_building+=/hand_of_guldan,if=soul_shard>=5
actions.nether_portal_building+=/call_action_list,name=build_a_shard

head=horrific_amalgams_hood,id=160616,bonus_id=4824/1507/4775,azerite_powers=458/30/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536,azerite_level=33
shoulders=amice_of_corrupting_horror,id=160726,bonus_id=4824/1507/4775,azerite_powers=483/22/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=robes_of_the_unraveler,id=160614,bonus_id=4824/1507/4775,azerite_powers=483/30/13
wrists=voidlashed_wristband,id=160617,bonus_id=4800/1507
hands=mutagenic_protofluid_handwraps,id=160715,bonus_id=4800/1507
waist=cord_of_septic_envelopment,id=160727,bonus_id=4800/1507
legs=leggings_of_lingering_infestation,id=160615,bonus_id=4800/1507
feet=volatile_walkers,id=160714,bonus_id=4800/1507
finger1=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=ignition_mages_fuse,id=159615,bonus_id=1542/4779
trinket2=vigilants_bloodshaper,id=160651,bonus_id=4800/1507
main_hand=tusk_of_the_reborn_prophet,id=160691,bonus_id=4800/1507,enchant=quick_navigation
off_hand=codex_of_imminent_ruin,id=160696,bonus_id=4800/1507

# Gear Summary
# gear_ilvl=385.25
# gear_stamina=7205
# gear_intellect=5476
# gear_crit_rating=913
# gear_haste_rating=1217
# gear_mastery_rating=742
# gear_versatility_rating=129
# gear_armor=1159
default_pet=felguard

DStr_ID_Imp : 17029 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17029.0 17029.0 15.3 / 0.090% 2134.3 / 12.5% 4.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
970.9 961.3 Mana 0.00% 47.4 100.0% 100%
Talents
  • 15: Demonic Strength (Demonology Warlock)
  • 30: Demonic Calling (Demonology Warlock)
  • 60: Summon Vilefiend (Demonology Warlock)
  • 90: Inner Demons (Demonology Warlock)
  • 100: Nether Portal (Demonology Warlock)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
DStr_ID_Imp 17029
Demonbolt 1332 7.8% 47.0 5.82sec 8506 7482 Direct 47.8 7114 14227 8361 17.5%  

Stats details: demonbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.97 47.79 0.00 0.00 1.1370 0.0000 399538.11 399538.11 0.00 7481.57 7481.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.41 82.47% 7114.33 6520 8308 7116.05 6914 7342 280371 280371 0.00
crit 8.38 17.53% 14227.17 13040 16616 14229.65 13161 16616 119167 119167 0.00
 
 

Action details: demonbolt

Static Values
  • id:264178
  • school:shadowflame
  • resource:mana
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:264178
  • name:Demonbolt
  • school:shadowflame
  • tooltip:
  • description:Send the fiery soul of a fallen demon at the enemy, causing {$s1=0} Shadowflame damage.$?c2[ |cFFFFFFFFGenerates 2 Soul Shards.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.667000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Hand of Gul'dan 1098 6.5% 62.9 4.72sec 5240 4747 Direct 62.7 4464 8914 5251 17.7%  

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.88 62.74 0.00 0.00 1.1039 0.0000 329460.57 329460.57 0.00 4746.59 4746.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.64 82.32% 4464.35 1634 5979 4458.42 4021 4827 230564 230564 0.00
crit 11.10 17.68% 8913.89 3267 11958 8900.94 4477 10892 98896 98896 0.00
 
 

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadowflame
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.7000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:2.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadowflame
  • tooltip:
  • description:Calls down a demonic meteor full of Wild Imps which burst forth to attack the target. Deals up to ${$m1*$86040m1} Shadowflame damage on impact to all enemies within $86040A1 yds of the target{$?s196283=false}[, applies Doom to each target,][] and summons up to ${$m1*{$104317m2=0}} Wild Imps, based on Soul Shards consumed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.160000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Heed My Call 142 (203) 0.8% (1.2%) 7.3 36.63sec 8298 0 Direct 7.3 4925 9849 5813 18.0%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.34 7.34 0.00 0.00 0.0000 0.0000 42676.44 42676.44 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.02 81.96% 4924.62 4925 4925 4922.65 0 4925 29629 29629 0.00
crit 1.32 18.04% 9849.24 9849 9849 7400.23 0 9849 13047 13047 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4620.00
  • base_dd_max:4620.00
 
    Heed My Call (_aoe) 61 0.4% 7.3 36.63sec 2485 0 Direct 7.3 2111 4221 2485 17.8%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.34 7.34 0.00 0.00 0.0000 0.0000 18244.73 18244.73 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.04 82.25% 2110.55 2111 2111 2109.71 0 2111 12744 12744 0.00
crit 1.30 17.75% 4221.10 4221 4221 3087.09 0 4221 5501 5501 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1980.00
  • base_dd_max:1980.00
 
Shadow Bolt 1318 7.8% 94.1 3.13sec 4200 2816 Direct 93.4 3593 7185 4230 17.7%  

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.08 93.42 0.00 0.00 1.4917 0.0000 395144.18 395144.18 0.00 2815.84 2815.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.86 82.28% 3593.16 3335 4297 3593.71 3551 3656 276172 276172 0.00
crit 16.56 17.72% 7185.23 6670 8595 7186.48 6915 7613 118972 118972 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=0} Shadow damage.$?c2[ |cFFFFFFFFGenerates 1 Soul Shard.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.345000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Volatile Blood Explosion 288 1.7% 7.2 37.12sec 11917 0 Direct 7.1 10240 20481 12085 18.0%  

Stats details: volatile_blood_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.25 7.15 0.00 0.00 0.0000 0.0000 86376.96 86376.96 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.86 81.99% 10240.44 10240 10240 10236.34 0 10240 60017 60017 0.00
crit 1.29 18.01% 20480.88 20481 20481 14872.09 0 20481 26360 26360 0.00
 
 

Action details: volatile_blood_explosion

Static Values
  • id:278057
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278057
  • name:Volatile Blood Explosion
  • school:shadow
  • tooltip:
  • description:Your damaging spells have a chance to launch an orb of charged blood at your target, dealing {$s1=4788} Shadow damage split among all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9607.38
  • base_dd_max:9607.38
 
pet - imp 3140 / 3140
Firebolt 3140 18.5% 103.8 2.89sec 9061 6929 Direct 103.0 7759 15520 9133 17.7%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.82 103.00 0.00 0.00 1.3077 0.0000 940722.06 940722.06 0.00 6928.89 6928.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.76 82.29% 7759.01 7027 9401 7760.06 7612 7901 657638 657638 0.00
crit 18.24 17.71% 15520.35 14053 18802 15520.79 14567 17326 283084 283084 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.568000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - wrathguard 1687 / 258
melee 816 0.7% 47.6 2.76sec 775 650 Direct 47.6 660 1320 775 17.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.58 47.58 0.00 0.00 1.1923 0.0000 36887.11 52734.55 30.05 650.23 650.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.23 82.46% 659.52 562 753 658.85 566 739 25874 36991 30.05
crit 8.35 17.54% 1319.51 1125 1505 1302.26 0 1505 11013 15744 29.68
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 408 0.4% 47.6 2.76sec 388 307 Direct 47.6 330 660 388 17.6%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.58 47.58 0.00 0.00 1.2615 0.0000 18446.57 26371.59 30.05 307.33 307.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.22 82.44% 329.77 281 376 329.39 285 369 12934 18491 30.05
crit 8.36 17.56% 659.65 562 753 651.28 0 753 5512 7881 29.68
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Overhead Assault 462 0.4% 10.1 13.50sec 2094 2094 Direct 10.1 1779 3557 2094 17.7%  

Stats details: overhead_assault

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.06 10.06 0.00 0.00 1.0000 0.0000 21061.54 30109.99 30.05 2094.01 2094.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.28 82.29% 1779.03 1519 2032 1776.98 0 2008 14725 21051 30.00
crit 1.78 17.71% 3557.23 3037 4064 2758.60 0 4064 6337 9059 23.30
 
 

Action details: overhead_assault

Static Values
  • id:272432
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272432
  • name:Overhead Assault
  • school:physical
  • tooltip:
  • description:The Wrathguard smashes its target with a heavy overhand swing.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - void_terror 1803 / 274
Double Breath 0 (149) 0.0% (0.9%) 0.0 0.00sec 0 7303

Stats details: double_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 7303.27 7303.27
 
 

Action details: double_breath

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (1) 489 0.4% 8.0 17.34sec 2780 0 Direct 8.0 2366 4729 2780 17.5%  

Stats details: double_breath1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.96 7.96 0.00 0.00 0.0000 0.0000 22119.43 22119.43 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.56 82.49% 2366.18 2026 2711 2359.08 0 2711 15529 15529 0.00
crit 1.39 17.51% 4728.94 4053 5422 3357.68 0 5422 6590 6590 0.00
 
 

Action details: double_breath1

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (2) 491 0.4% 8.0 17.34sec 2784 0 Direct 8.0 2366 4733 2784 17.7%  

Stats details: double_breath2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.96 7.96 0.00 0.00 0.0000 0.0000 22153.01 22153.01 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.55 82.32% 2365.80 2026 2711 2352.27 0 2646 15496 15496 0.00
crit 1.41 17.68% 4732.52 4053 5422 3408.09 0 5422 6657 6657 0.00
 
 

Action details: double_breath2

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
melee 822 0.7% 47.7 2.74sec 775 649 Direct 47.7 660 1319 775 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.67 47.67 0.00 0.00 1.1940 0.0000 36958.56 52836.71 30.05 649.36 649.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.29 82.43% 659.52 562 753 658.64 569 741 25913 37046 30.05
crit 8.38 17.57% 1318.58 1125 1505 1299.54 0 1505 11046 15791 29.66
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - vilefiend 3122 / 1558
Bile Spit 1096 3.2% 6.8 47.18sec 23937 0 Direct 6.8 8825 17651 10382 17.6%  
Periodic 33.4 2777 0 2777 0.0% 22.3%

Stats details: bile_spit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.84 6.83 33.44 33.44 0.0000 2.0000 163734.07 163734.07 0.00 2448.32 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.62 82.36% 8824.85 8474 10104 8824.73 8630 9547 49618 49618 0.00
crit 1.20 17.64% 17650.66 16947 20207 12975.83 0 20207 21262 21262 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.4 100.00% 2776.91 2502 3310 2777.29 2622 2868 92854 92854 0.00
 
 

Action details: bile_spit

Static Values
  • id:267997
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:65.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267997
  • name:Bile Spit
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:The Vilefiend spits a ball of bile at its target, dealing ${$m1*$<demoMastery>} Nature damage and an additional ${$m2*$<demoMastery>} Nature damage every $t2 sec for {$d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.680000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.200000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Headbutt 732 2.1% 30.1 9.82sec 3645 3645 Direct 30.1 3100 6201 3645 17.6%  

Stats details: headbutt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.07 30.07 0.00 0.00 1.0000 0.0000 109602.12 156689.40 30.05 3644.54 3644.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.79 82.43% 3099.79 2737 3621 3100.68 2938 3219 76844 109858 30.05
crit 5.28 17.57% 6200.83 5474 7243 6158.58 0 7243 32758 46831 29.85
 
 

Action details: headbutt

Static Values
  • id:267999
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267999
  • name:Headbutt
  • school:physical
  • tooltip:
  • description:The Vilefiend rams its bladed head into the target, dealing {$s1=0} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1294 3.8% 107.8 2.71sec 1795 1339 Direct 107.8 1526 3050 1795 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.78 107.78 0.00 0.00 1.3404 0.0000 193443.65 276550.93 30.05 1339.09 1339.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.75 82.35% 1525.78 1337 1775 1526.15 1454 1575 135421 193600 30.05
crit 19.02 17.65% 3050.38 2673 3550 3051.16 2772 3298 58023 82951 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - vicious_hellhound 1049 / 160
Demon Fangs 650 0.6% 10.5 12.40sec 2794 2794 Direct 10.5 2373 4746 2794 17.7%  

Stats details: demon_fangs

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.53 10.53 0.00 0.00 1.0000 0.0000 29405.15 29405.15 0.00 2793.84 2793.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.66 82.29% 2373.42 2026 2711 2368.44 0 2711 20557 20557 0.00
crit 1.86 17.71% 4746.22 4053 5422 3763.64 0 5422 8848 8848 0.00
 
 

Action details: demon_fangs

Static Values
  • id:272013
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272013
  • name:Demon Fangs
  • school:shadowflame
  • tooltip:
  • description:The Vicious Hellhound chomps at its target, dealing Shadowflame damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 399 0.4% 92.1 1.37sec 194 319 Direct 92.1 165 331 194 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.14 92.14 0.00 0.00 0.6102 0.0000 17913.76 25609.87 30.05 318.61 318.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.89 82.37% 165.28 141 188 165.09 142 184 12544 17933 30.05
crit 16.25 17.63% 330.51 281 376 329.60 0 376 5370 7677 30.00
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - dreadstalker 3375 / 2226
Dreadbite 1069 4.1% 29.0 21.05sec 7277 0 Direct 29.0 6175 12350 7277 17.8%  

Stats details: dreadbite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.05 29.05 0.00 0.00 0.0000 0.0000 211388.19 211388.19 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.87 82.16% 6174.95 5711 7613 6175.25 5946 6380 147376 147376 0.00
crit 5.18 17.84% 12350.05 11423 15227 12292.76 0 15227 64012 64012 0.00
 
 

Action details: dreadbite

Static Values
  • id:205196
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205196
  • name:Dreadbite
  • school:shadow
  • tooltip:
  • description:Bite the target, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 2306 8.9% 311.9 1.89sec 1462 1106 Direct 311.9 1243 2486 1462 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 311.89 311.89 0.00 0.00 1.3220 0.0000 456113.18 652068.57 30.05 1106.26 1106.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 256.74 82.32% 1242.59 1105 1473 1242.76 1221 1261 319023 456082 30.05
crit 55.15 17.68% 2485.94 2211 2947 2486.43 2370 2598 137090 195987 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.83
 
pet - urzul 1304 / 198
Many Faced Bite 489 0.4% 10.6 12.74sec 2087 2087 Direct 10.6 1778 3551 2087 17.4%  

Stats details: many_faced_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.64 10.64 0.00 0.00 1.0000 0.0000 22207.36 31748.09 30.05 2087.16 2087.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.79 82.56% 1777.66 1519 2032 1773.01 0 1983 15617 22327 29.98
crit 1.86 17.44% 3551.47 3037 4064 2807.25 0 4064 6590 9421 23.75
 
 

Action details: many_faced_bite

Static Values
  • id:272439
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272439
  • name:Many Faced Bite
  • school:physical
  • tooltip:
  • description:The Ur'zul rears up and bites its target, dealing Physical damage. You're not sure which face actually bit you after thinking about it.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 815 0.7% 47.4 2.78sec 777 651 Direct 47.4 660 1319 777 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.38 47.38 0.00 0.00 1.1925 0.0000 36797.91 52607.03 30.05 651.33 651.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.97 82.24% 659.51 562 753 658.72 569 741 25698 36739 30.05
crit 8.41 17.76% 1319.26 1125 1505 1299.97 0 1505 11100 15868 29.64
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - wild_imp 3114 / 3045
Fel Firebolt 3114 17.9% 1217.7 0.24sec 750 508 Direct 1212.8 640 1279 753 17.7%  

Stats details: fel_firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1217.75 1212.81 0.00 0.00 1.4768 0.0000 912996.70 912996.70 0.00 507.67 507.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 998.45 82.33% 639.74 569 761 639.83 631 652 638750 638750 0.00
crit 214.36 17.67% 1279.35 1138 1523 1279.53 1250 1320 274247 274247 0.00
 
 

Action details: fel_firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Fel Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.046000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - demonic_tyrant 4672 / 822
Demonfire 4672 4.8% 37.7 6.88sec 6531 4900 Direct 37.6 5561 11121 6544 17.7%  

Stats details: demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.67 37.59 0.00 0.00 1.3328 0.0000 246016.72 246016.72 0.00 4899.95 4899.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.95 82.32% 5561.38 5029 5917 5564.73 5471 5674 172116 172116 0.00
crit 6.64 17.68% 11121.49 10059 11834 11118.39 0 11834 73901 73901 0.00
 
 

Action details: demonfire

Static Values
  • id:270481
  • school:shadowflame
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:270481
  • name:Demonfire
  • school:shadowflame
  • tooltip:
  • description:Deal {$s1=0} Shadowflame damage to your enemy target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.357500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - shivarra 1892 / 290
melee 814 0.7% 47.4 2.78sec 777 650 Direct 47.4 659 1319 777 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.43 47.43 0.00 0.00 1.1946 0.0000 36840.45 52667.84 30.05 650.21 650.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.99 82.21% 659.39 562 753 658.52 569 753 25710 36755 30.05
crit 8.44 17.79% 1318.93 1125 1505 1301.40 0 1505 11131 15913 29.69
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 407 0.4% 47.4 2.78sec 388 307 Direct 47.4 330 660 388 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.43 47.43 0.00 0.00 1.2646 0.0000 18410.00 26319.31 30.05 306.93 306.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.02 82.27% 329.69 281 376 329.26 285 376 12865 18392 30.05
crit 8.41 17.73% 659.51 562 753 648.35 0 753 5545 7927 29.58
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Multi-Slash 0 (103) 0.0% (0.6%) 0.0 0.00sec 0 3927

Stats details: multislash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 3927.16 3927.16
 
 

Action details: multislash

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (1) 167 0.1% 7.8 18.07sec 981 0 Direct 7.8 835 1670 981 17.5%  

Stats details: multislash1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.77 7.77 0.00 0.00 0.0000 0.0000 7617.69 10890.40 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.41 82.55% 835.19 717 959 831.93 0 959 5354 7654 29.94
crit 1.36 17.45% 1670.44 1434 1919 1174.79 0 1919 2264 3237 21.14
 
 

Action details: multislash1

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (2) 167 0.1% 7.8 18.07sec 980 0 Direct 7.8 835 1672 980 17.3%  

Stats details: multislash2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.77 7.77 0.00 0.00 0.0000 0.0000 7606.64 10874.60 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.42 82.74% 835.01 717 959 831.18 0 959 5365 7670 29.92
crit 1.34 17.26% 1672.18 1434 1919 1171.25 0 1919 2242 3205 21.05
 
 

Action details: multislash2

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (3) 168 0.2% 7.8 18.07sec 985 0 Direct 7.8 835 1670 985 17.9%  

Stats details: multislash3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.77 7.77 0.00 0.00 0.0000 0.0000 7648.76 10934.82 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.37 82.07% 835.22 717 959 831.81 0 959 5323 7609 29.93
crit 1.39 17.93% 1670.16 1434 1919 1192.74 0 1919 2326 3325 21.47
 
 

Action details: multislash3

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (4) 168 0.1% 7.8 18.07sec 981 0 Direct 7.8 835 1670 981 17.5%  

Stats details: multislash4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.77 7.77 0.00 0.00 0.0000 0.0000 7621.34 10895.62 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.41 82.48% 835.28 717 959 830.88 0 959 5350 7649 29.90
crit 1.36 17.52% 1669.57 1434 1919 1179.66 0 1919 2271 3247 21.24
 
 

Action details: multislash4

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - darkhound 1281 / 194
Fel Bite 464 0.4% 10.0 13.71sec 2100 2100 Direct 10.0 1779 3560 2100 18.0%  

Stats details: fel_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.96 9.96 0.00 0.00 1.0000 0.0000 20915.44 29901.13 30.05 2100.15 2100.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.17 82.00% 1779.43 1519 2032 1774.78 0 2032 14532 20775 29.96
crit 1.79 18.00% 3560.31 3037 4064 2791.05 0 4064 6384 9126 23.53
 
 

Action details: fel_bite

Static Values
  • id:272435
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272435
  • name:Fel Bite
  • school:physical
  • tooltip:
  • description:The Darkhound bites its target, causing serious Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 816 0.7% 47.1 2.82sec 776 651 Direct 47.1 660 1319 776 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.13 47.13 0.00 0.00 1.1931 0.0000 36586.99 52305.49 30.05 650.63 650.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.80 82.32% 659.63 562 753 658.99 569 749 25592 36586 30.05
crit 8.33 17.68% 1319.26 1125 1505 1299.72 0 1505 10995 15719 29.64
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - bilescourge 3767 / 569
Toxic Bile 3767 3.3% 60.2 2.13sec 2799 2957 Direct 60.1 2382 4764 2800 17.6%  

Stats details: toxic_bile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.16 60.14 0.00 0.00 0.9465 0.0000 168406.54 168406.54 0.00 2957.35 2957.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.58 82.44% 2382.20 2026 2711 2376.64 0 2698 118105 118105 0.00
crit 10.56 17.56% 4763.59 4053 5422 4723.92 0 5422 50301 50301 0.00
 
 

Action details: toxic_bile

Static Values
  • id:272167
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272167
  • name:Toxic Bile
  • school:nature
  • tooltip:
  • description:The Bilescourge spits wads of Toxic Bile at its target, dealing Nature damage.
 
pet - illidari_satyr 1229 / 186
melee 403 0.4% 46.3 2.75sec 388 324 Direct 46.3 330 660 388 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.35 46.35 0.00 0.00 1.1963 0.0000 17986.08 25713.26 30.05 324.40 324.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.15 82.31% 329.74 281 376 329.34 283 376 12579 17984 30.05
crit 8.20 17.69% 659.51 562 753 649.71 0 753 5407 7729 29.64
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 202 0.2% 46.3 2.75sec 194 153 Direct 46.3 165 330 194 17.8%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.35 46.35 0.00 0.00 1.2666 0.0000 8998.11 12863.88 30.05 153.28 153.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.12 82.24% 164.89 141 188 164.69 142 188 6285 8985 30.05
crit 8.23 17.76% 329.61 281 376 324.52 0 376 2713 3879 29.64
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Shadow Slash 624 0.6% 10.1 12.98sec 2788 2788 Direct 10.1 2375 4751 2788 17.4%  

Stats details: shadow_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.06 10.06 0.00 0.00 1.0000 0.0000 28040.24 28040.24 0.00 2788.41 2788.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.31 82.60% 2374.69 2026 2711 2370.23 0 2711 19727 19727 0.00
crit 1.75 17.40% 4751.41 4053 5422 3715.71 0 5422 8314 8314 0.00
 
 

Action details: shadow_slash

Static Values
  • id:272012
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272012
  • name:Shadow Slash
  • school:shadow
  • tooltip:
  • description:The Satyr strikes at out with its weapons, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - eye_of_guldan 969 / 82
Eye of Gul'dan 969 0.5% 28.2 5.39sec 862 1129 Periodic 61.0 399 0 399 0.0% 59.8%

Stats details: eye_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.25 0.00 61.02 61.02 0.7637 2.9395 24348.84 24348.84 0.00 121.18 1128.72
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.0 100.00% 399.06 151 484 397.70 350 429 24349 24349 0.00
 
 

Action details: eye_of_guldan

Static Values
  • id:272131
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272131
  • name:Eye of Gul'dan
  • school:shadowflame
  • tooltip:Suffering Shadow damage every $t1 sec.
  • description:The Eye of Gul'dan stares deep into the target's soul, causing Shadow Damage every $t1 sec for {$d=15 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.300000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - prince_malchezaar 4990 / 402
melee 3325 1.6% 21.6 1.59sec 3684 3101 Direct 21.6 3130 6250 3684 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.59 21.59 0.00 0.00 1.1879 0.0000 79520.65 113684.32 30.05 3100.82 3100.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.76 82.26% 3130.30 2665 3566 3121.96 2697 3509 55591 79474 30.05
crit 3.83 17.74% 6250.03 5350 7131 5879.35 0 7018 23930 34211 28.35
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 1665 0.8% 21.6 1.59sec 1843 1467 Direct 21.6 1564 3132 1843 17.8%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.59 21.59 0.00 0.00 1.2562 0.0000 39779.23 56869.18 30.05 1466.84 1466.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.76 82.25% 1564.43 1333 1783 1560.37 1350 1755 27777 39710 30.05
crit 3.83 17.75% 3131.68 2665 3566 3018.65 0 3566 12003 17159 29.02
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
DStr_ID_Imp
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_ID_Imp
  • harmful:false
  • if_expr:
 
Berserking 2.0 186.91sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:pet.demonic_tyrant.active|target.time_to_die<=15
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Call Dreadstalkers 14.6 21.04sec

Stats details: call_dreadstalkers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.58 0.00 0.00 0.00 1.2030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: call_dreadstalkers

Static Values
  • id:104316
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:20.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
Spelldata
  • id:104316
  • name:Call Dreadstalkers
  • school:shadow
  • tooltip:
  • description:Summons {$s1=2} ferocious Dreadstalkers to attack the target for {$193332d=12 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_ID_Imp
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_ID_Imp
  • harmful:false
  • if_expr:
 
inner_demons 1.0 0.00sec

Stats details: inner_demons

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: inner_demons

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.inner_demons.enabled
 
Nether Portal 2.0 0.00sec

Stats details: nether_portal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.2380 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: nether_portal

Static Values
  • id:267217
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Spelldata
  • id:267217
  • name:Nether Portal
  • school:shadow
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Summon Demonic Tyrant 3.6 93.54sec

Stats details: summon_demonic_tyrant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.58 0.00 0.00 0.00 1.5073 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_demonic_tyrant

Static Values
  • id:265187
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
Spelldata
  • id:265187
  • name:Summon Demonic Tyrant
  • school:shadow
  • tooltip:
  • description:Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.
 
summon_random_demon 17.8 14.61sec

Stats details: summon_random_demon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.81 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_random_demon

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
 
Summon Vilefiend 6.8 47.18sec

Stats details: summon_vilefiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.84 0.00 0.00 0.00 1.5522 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_vilefiend

Static Values
  • id:264119
  • school:fire
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Spelldata
  • id:264119
  • name:Summon Vilefiend
  • school:fire
  • tooltip:
  • description:Summon a Vilefiend to fight for you for the next {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:28.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=7}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 100.9sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 186.9sec 186.9sec 6.76% 8.58% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Demonic Calling 12.8 15.8 23.2sec 10.1sec 52.15% 83.73% 15.8(15.8) 0.1

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_calling_1:52.15%

Trigger Attempt Success

  • trigger_pct:20.13%

Spelldata details

  • id:205146
  • name:Demonic Calling
  • tooltip:Your next Call Dreadstalkers costs {$205145s1=1} less Soul Shard and has no cast time.
  • description:{$@spelldesc205145=Shadow Bolt{$?s264178=true}[ and Demonbolt have][ has] a {$h=20}% chance to make your next Call Dreadstalkers cost {$s1=1} less Soul Shard and have no cast time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Demonic Core 24.5 32.0 11.7sec 5.0sec 40.31% 100.00% 4.8(4.8) 0.4

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_demonic_core
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_core_1:16.52%
  • demonic_core_2:15.93%
  • demonic_core_3:5.40%
  • demonic_core_4:2.45%

Trigger Attempt Success

  • trigger_pct:23.54%

Spelldata details

  • id:264173
  • name:Demonic Core
  • tooltip:The cast time of Demonbolt is reduced by {$s1=100}%.
  • description:{$@spelldesc267102=When your Wild Imps expend all of their energy or are imploded, you have a {$s1=10}% chance to absorb their life essence, granting you a stack of Demonic Core. When your summoned Dreadstalkers fade away, you have a {$s2=100}% chance to absorb their life essence, granting you a stack of Demonic Core. Demonic Core reduces the cast time of Demonbolt by {$264173s1=100}%. Maximum {$264173u=4} stacks.}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Demonic Power 3.6 0.0 93.5sec 93.5sec 17.61% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_demonic_power
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_power_1:17.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:265273
  • name:Demonic Power
  • tooltip:Damage dealt by your demons increased by {$s2=15}%.
  • description:{$@spelldesc265187=Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
dreadstalkers 11.6 17.6 26.7sec 10.1sec 65.97% 0.00% 0.0(0.0) 10.9

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_dreadstalkers
  • max_stacks:4
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • dreadstalkers_2:59.59%
  • dreadstalkers_4:6.38%

Trigger Attempt Success

  • trigger_pct:100.00%
eyes_of_guldan 0.2 0.5 167.4sec 2.9sec 1.36% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_eyes_of_guldan
  • max_stacks:4
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • eyes_of_guldan_4:1.36%

Trigger Attempt Success

  • trigger_pct:100.00%
Ignition Mage's Fuse 2.4 0.0 171.7sec 171.7sec 14.83% 0.00% 2.0(2.0) 2.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:275.80

Stack Uptimes

  • ignition_mages_fuse_1:3.12%
  • ignition_mages_fuse_2:3.08%
  • ignition_mages_fuse_3:3.04%
  • ignition_mages_fuse_4:2.88%
  • ignition_mages_fuse_5:2.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Nether Portal 2.0 0.0 182.9sec 0.0sec 10.14% 17.97% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_nether_portal
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • nether_portal_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267217
  • name:Nether Portal
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Overwhelming Power 4.3 2.9 66.7sec 36.7sec 44.25% 0.00% 2.9(40.7) 0.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • overwhelming_power_1:1.30%
  • overwhelming_power_2:1.34%
  • overwhelming_power_3:1.37%
  • overwhelming_power_4:1.41%
  • overwhelming_power_5:1.45%
  • overwhelming_power_6:1.49%
  • overwhelming_power_7:1.52%
  • overwhelming_power_8:1.57%
  • overwhelming_power_9:1.60%
  • overwhelming_power_10:1.65%
  • overwhelming_power_11:1.69%
  • overwhelming_power_12:1.73%
  • overwhelming_power_13:1.78%
  • overwhelming_power_14:1.83%
  • overwhelming_power_15:1.88%
  • overwhelming_power_16:1.93%
  • overwhelming_power_17:1.98%
  • overwhelming_power_18:2.04%
  • overwhelming_power_19:2.09%
  • overwhelming_power_20:2.15%
  • overwhelming_power_21:2.21%
  • overwhelming_power_22:2.28%
  • overwhelming_power_23:2.35%
  • overwhelming_power_24:2.41%
  • overwhelming_power_25:1.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
portal_summons 2.0 13.3 182.9sec 14.5sec 19.52% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_portal_summons
  • max_stacks:40
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • portal_summons_1:1.70%
  • portal_summons_2:0.77%
  • portal_summons_3:1.25%
  • portal_summons_4:1.52%
  • portal_summons_5:1.85%
  • portal_summons_6:1.81%
  • portal_summons_7:3.99%
  • portal_summons_8:5.87%
  • portal_summons_9:0.74%

Trigger Attempt Success

  • trigger_pct:100.00%
prince_malchezaar 0.2 0.0 162.9sec 104.3sec 1.42% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_prince_malchezaar
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • prince_malchezaar_1:1.42%

Trigger Attempt Success

  • trigger_pct:100.00%
Quick Navigation 6.0 22.4 52.2sec 10.3sec 67.51% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:17.71%
  • quick_navigation_2:17.12%
  • quick_navigation_3:16.58%
  • quick_navigation_4:16.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.3 0.0 52.2sec 52.2sec 17.49% 0.00% 0.0(0.0) 5.2

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:17.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Supreme Commander 4.3 0.1 82.6sec 79.8sec 17.01% 0.00% 0.1(0.1) 3.3

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_supreme_commander
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:838.00

Stack Uptimes

  • supreme_commander_1:17.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279878
  • name:Supreme Commander
  • tooltip:
  • description:When your Demonic Tyrant expires, consume its life essence, granting you a stack of Demonic Core and increasing your Intellect by {$s1=398} for {$279885d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tyrant 3.6 0.0 93.5sec 93.5sec 17.61% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_tyrant
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • tyrant_1:17.61%

Trigger Attempt Success

  • trigger_pct:100.00%
vilefiend 6.8 0.0 47.2sec 47.2sec 49.96% 0.00% 0.0(0.0) 6.4

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_vilefiend
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vilefiend_1:49.96%

Trigger Attempt Success

  • trigger_pct:100.00%
wild_imps 2.0 188.1 132.8sec 0.0sec 97.78% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_wild_imps
  • max_stacks:40
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • wild_imps_1:1.42%
  • wild_imps_2:2.05%
  • wild_imps_3:10.37%
  • wild_imps_4:20.96%
  • wild_imps_5:8.11%
  • wild_imps_6:14.85%
  • wild_imps_7:18.51%
  • wild_imps_8:5.01%
  • wild_imps_9:3.52%
  • wild_imps_10:3.96%
  • wild_imps_11:4.18%
  • wild_imps_12:1.71%
  • wild_imps_13:1.22%
  • wild_imps_14:1.30%
  • wild_imps_15:0.36%
  • wild_imps_16:0.16%
  • wild_imps_17:0.07%
  • wild_imps_18:0.01%
  • wild_imps_19:0.00%
  • wild_imps_20:0.00%
  • wild_imps_21:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Inner Demons

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_inner_demons
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:12.00

Stack Uptimes

  • inner_demons_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267216
  • name:Inner Demons
  • tooltip:
  • description:You passively summon a Wild Imp to fight for you every $t1 sec, and have a {$s1=10}% chance to also summon an additional Demon to fight for you for {$s2=15} sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
summon_random_demon 17.8 13.9sec
one_shard_hog 9.0 22.0sec
two_shard_hog 4.2 48.8sec
three_shard_hog 49.7 5.7sec
portal_summon 15.3 13.7sec

Resources

Resource Usage Type Count Total Average RPE APR
DStr_ID_Imp
call_dreadstalkers Soul Shard 14.6 16.9 1.2 1.2 0.0
demonbolt Mana 48.0 95936.4 2000.0 2042.5 4.2
hand_of_guldan Soul Shard 62.9 166.5 2.6 2.6 1978.7
shadow_bolt Mana 94.1 188153.5 2000.0 2000.0 2.1
summon_demonic_tyrant Mana 3.6 7158.9 2000.0 2000.2 0.0
summon_vilefiend Soul Shard 6.8 6.8 1.0 1.0 0.0
pet - imp
firebolt Energy 103.8 4152.7 40.0 40.0 226.5
pet - wild_imp
fel_firebolt Energy 1217.7 18634.1 15.3 15.3 49.0
Resource Gains Type Count Total Average Overflow
demonbolt Soul Shard 47.97 95.81 (50.46%) 2.00 0.13 0.13%
shadow_bolt Soul Shard 94.08 94.07 (49.54%) 1.00 0.01 0.01%
mana_regen Mana 557.62 288375.74 (100.00%) 517.16 11081.52 3.70%
pet - imp
energy_regen Energy 425.65 3981.63 (100.00%) 9.35 22.74 0.57%
pet - demonic_tyrant
energy_regen Energy 37.67 0.00 (0.00%) 0.00 760.41 100.00%
pet - bilescourge
energy_regen Energy 12.01 0.00 (0.00%) 0.00 166.61 100.00%
pet - bilescourge
energy_regen Energy 15.25 0.00 (0.00%) 0.00 212.09 100.00%
pet - bilescourge
energy_regen Energy 13.08 0.00 (0.00%) 0.00 182.35 100.00%
pet - bilescourge
energy_regen Energy 9.67 0.00 (0.00%) 0.00 135.02 100.00%
pet - bilescourge
energy_regen Energy 8.91 0.00 (0.00%) 0.00 123.65 100.00%
Resource RPS-Gain RPS-Loss
Mana 961.30 970.87
Soul Shard 0.63 0.63
Combat End Resource Mean Min Max
Mana 97106.38 91653.00 100000.00
Soul Shard 2.62 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.1%

Statistics & Data Analysis

Fight Length
Sample Data DStr_ID_Imp Fight Length
Count 4999
Mean 299.99
Minimum 240.01
Maximum 359.96
Spread ( max - min ) 119.95
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data DStr_ID_Imp Damage Per Second
Count 4999
Mean 17029.05
Minimum 15508.30
Maximum 19258.75
Spread ( max - min ) 3750.44
Range [ ( max - min ) / 2 * 100% ] 11.01%
Standard Deviation 551.3981
5th Percentile 16206.39
95th Percentile 18017.73
( 95th Percentile - 5th Percentile ) 1811.34
Mean Distribution
Standard Deviation 7.7987
95.00% Confidence Intervall ( 17013.76 - 17044.33 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4028
0.1 Scale Factor Error with Delta=300 2596
0.05 Scale Factor Error with Delta=300 10382
0.01 Scale Factor Error with Delta=300 259546
Priority Target DPS
Sample Data DStr_ID_Imp Priority Target Damage Per Second
Count 4999
Mean 17029.05
Minimum 15508.30
Maximum 19258.75
Spread ( max - min ) 3750.44
Range [ ( max - min ) / 2 * 100% ] 11.01%
Standard Deviation 551.3981
5th Percentile 16206.39
95th Percentile 18017.73
( 95th Percentile - 5th Percentile ) 1811.34
Mean Distribution
Standard Deviation 7.7987
95.00% Confidence Intervall ( 17013.76 - 17044.33 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4028
0.1 Scale Factor Error with Delta=300 2596
0.05 Scale Factor Error with Delta=300 10382
0.01 Scale Factor Error with Delta=300 259546
DPS(e)
Sample Data DStr_ID_Imp Damage Per Second (Effective)
Count 4999
Mean 17029.05
Minimum 15508.30
Maximum 19258.75
Spread ( max - min ) 3750.44
Range [ ( max - min ) / 2 * 100% ] 11.01%
Damage
Sample Data DStr_ID_Imp Damage
Count 4999
Mean 1271440.99
Minimum 911566.41
Maximum 1672513.40
Spread ( max - min ) 760946.99
Range [ ( max - min ) / 2 * 100% ] 29.92%
DTPS
Sample Data DStr_ID_Imp Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data DStr_ID_Imp Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data DStr_ID_Imp Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data DStr_ID_Imp Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data DStr_ID_Imp Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data DStr_ID_Imp Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data DStr_ID_ImpTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data DStr_ID_Imp Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 inner_demons,if=talent.inner_demons.enabled
5 0.00 snapshot_stats
6 0.00 potion
7 0.00 demonbolt
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,if=pet.demonic_tyrant.active|target.time_to_die<30
9 2.37 use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
A 2.00 berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
0.00 demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
B 0.00 call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
C 0.00 call_action_list,name=implosion,if=spell_targets.implosion>1
0.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
D 4.87 summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
E 11.56 call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
F 1.59 summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
0.00 doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
G 46.18 hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
0.00 soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
H 42.89 demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
0.00 bilescourge_bombers
I 0.00 call_action_list,name=build_a_shard
actions.build_a_shard
# count action,conditions
0.00 demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
0.00 soul_strike
J 94.58 shadow_bolt
actions.nether_portal_active
# count action,conditions
0.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
N 2.00 summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
O 2.00 call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
P 0.00 call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
Q 14.43 hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
R 1.96 summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
S 0.04 summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
T 4.08 demonbolt,if=buff.demonic_core.up
U 0.00 call_action_list,name=build_a_shard
actions.nether_portal_building
# count action,conditions
V 2.00 nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
W 1.03 call_dreadstalkers
X 0.55 hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
Y 1.94 hand_of_guldan,if=soul_shard>=5
Z 0.00 call_action_list,name=build_a_shard

Sample Sequence

0123467VNOQJQR9AJQJQJQJQJQJQJJJJEGHJGHHGHGHJGHHGHJJGEJDJJGJHGHHGJJEJGJJHGJJGJJJJJGHEHGDJJF8GJJJJJGEJJGHJGHHGHGHHJGEJJGJJJDHGHJJGEJJGHJJJYJJJYJWJJJYJJJVQQTNJOQR9ATQJQJQJJJGJJJHEGJJGHHGHGHHGHGHJJEJDGJHGJJHGHHGJEJGJHGHHGJJGJJHJGEHHGDJFJGJJJJJ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask DStr_ID_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food DStr_ID_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 augmentation DStr_ID_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_imp Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 4 inner_demons Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 potion Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard battle_potion_of_intellect
0:00.000 precombat 7 demonbolt Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard battle_potion_of_intellect
0:00.000 nether_portal_building V nether_portal Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard archive_of_the_titans, battle_potion_of_intellect
0:01.277 nether_portal_active N summon_vilefiend Fluffy_Pillow 99277.0/100000: 99% mana | 5.0/5: 100% soul_shard bloodlust, nether_portal, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:02.584 nether_portal_active O call_dreadstalkers Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, nether_portal, vilefiend, portal_summons(2), archive_of_the_titans, battle_potion_of_intellect
0:03.892 nether_portal_active Q hand_of_guldan Fluffy_Pillow 100000.0/100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, portal_summons(3), archive_of_the_titans, battle_potion_of_intellect
0:04.876 build_a_shard J shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, portal_summons(4), archive_of_the_titans, battle_potion_of_intellect
0:06.184 nether_portal_active Q hand_of_guldan Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard bloodlust, nether_portal, wild_imps, dreadstalkers(2), vilefiend, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:07.161 nether_portal_active R summon_demonic_tyrant Fluffy_Pillow 98981.0/100000: 99% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, portal_summons(5), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:08.461 default 9 use_items Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:08.461 default A berserking Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.461 build_a_shard J shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.555 nether_portal_active Q hand_of_guldan Fluffy_Pillow 97098.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:10.377 build_a_shard J shadow_bolt Fluffy_Pillow 97920.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:11.471 nether_portal_active Q hand_of_guldan Fluffy_Pillow 97014.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:12.287 build_a_shard J shadow_bolt Fluffy_Pillow 97830.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:13.376 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96919.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.168 build_a_shard J shadow_bolt Fluffy_Pillow 97711.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.221 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96764.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.016 build_a_shard J shadow_bolt Fluffy_Pillow 97559.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:17.068 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96611.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.834 build_a_shard J shadow_bolt Fluffy_Pillow 97377.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.855 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96398.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.739 build_a_shard J shadow_bolt Fluffy_Pillow 97282.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(3), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:20.906 build_a_shard J shadow_bolt Fluffy_Pillow 96449.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(3), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.038 build_a_shard J shadow_bolt Fluffy_Pillow 95581.0/100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(4), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:23.165 build_a_shard J shadow_bolt Fluffy_Pillow 94708.0/100000: 95% mana | 3.0/5: 60% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(4), archive_of_the_titans(5), ignition_mages_fuse(4)
0:24.292 default E call_dreadstalkers Fluffy_Pillow 93835.0/100000: 94% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, portal_summons(8), quick_navigation(4), archive_of_the_titans(5), ignition_mages_fuse(4)
0:25.137 default G hand_of_guldan Fluffy_Pillow 94680.0/100000: 95% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(4), archive_of_the_titans(6), ignition_mages_fuse(5)
0:25.958 default H demonbolt Fluffy_Pillow 95501.0/100000: 96% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(4), archive_of_the_titans(6), ignition_mages_fuse(5)
0:26.779 build_a_shard J shadow_bolt Fluffy_Pillow 94322.0/100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(4), archive_of_the_titans(6), ignition_mages_fuse(5)
0:27.874 default G hand_of_guldan Fluffy_Pillow 93417.0/100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(4), archive_of_the_titans(6), ignition_mages_fuse(5)
0:28.695 default H demonbolt Fluffy_Pillow 94238.0/100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(5), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(4), archive_of_the_titans(6)
0:29.654 default H demonbolt Fluffy_Pillow 93197.0/100000: 93% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(3), dreadstalkers(4), vilefiend, quick_navigation(4), archive_of_the_titans(6)
0:30.613 default G hand_of_guldan Fluffy_Pillow 92156.0/100000: 92% mana | 4.0/5: 80% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(4), vilefiend, quick_navigation(4), archive_of_the_titans(7)
0:31.571 default H demonbolt Fluffy_Pillow 93114.0/100000: 93% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(7)
0:32.529 default G hand_of_guldan Fluffy_Pillow 92072.0/100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(7)
0:33.488 default H demonbolt Fluffy_Pillow 93031.0/100000: 93% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(8), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(7)
0:34.446 build_a_shard J shadow_bolt Fluffy_Pillow 91989.0/100000: 92% mana | 2.0/5: 40% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(7)
0:35.723 default G hand_of_guldan Fluffy_Pillow 91266.0/100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(9), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(8)
0:36.683 default H demonbolt Fluffy_Pillow 92226.0/100000: 92% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(8), quick_navigation(4), archive_of_the_titans(8)
0:37.642 default H demonbolt Fluffy_Pillow 91185.0/100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(7), quick_navigation(4), archive_of_the_titans(8)
0:38.601 default G hand_of_guldan Fluffy_Pillow 90144.0/100000: 90% mana | 4.0/5: 80% soul_shard bloodlust, demonic_calling, wild_imps(10), quick_navigation(4), archive_of_the_titans(8)
0:39.559 default H demonbolt Fluffy_Pillow 91102.0/100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core, demonic_calling, wild_imps(8), quick_navigation(4), archive_of_the_titans(8)
0:40.519 build_a_shard J shadow_bolt Fluffy_Pillow 90062.0/100000: 90% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, wild_imps(7), quick_navigation(4), archive_of_the_titans(9)
0:41.795 build_a_shard J shadow_bolt Fluffy_Pillow 89338.0/100000: 89% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), quick_navigation_final, archive_of_the_titans(9)
0:43.379 default G hand_of_guldan Fluffy_Pillow 88922.0/100000: 89% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(6), quick_navigation_final, archive_of_the_titans(9)
0:44.566 default E call_dreadstalkers Fluffy_Pillow 90109.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), quick_navigation_final, archive_of_the_titans(9)
0:45.755 build_a_shard J shadow_bolt Fluffy_Pillow 91298.0/100000: 91% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(10)
0:47.337 default D summon_vilefiend Fluffy_Pillow 90880.0/100000: 91% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(10)
0:49.165 build_a_shard J shadow_bolt Fluffy_Pillow 92708.0/100000: 93% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(10)
0:50.749 build_a_shard J shadow_bolt Fluffy_Pillow 92292.0/100000: 92% mana | 2.0/5: 40% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(11)
0:52.331 default G hand_of_guldan Fluffy_Pillow 91874.0/100000: 92% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(11)
0:53.601 build_a_shard J shadow_bolt Fluffy_Pillow 93144.0/100000: 93% mana | 0.0/5: 0% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(11)
0:55.289 default H demonbolt Fluffy_Pillow 92832.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(12)
0:56.559 default G hand_of_guldan Fluffy_Pillow 92102.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(12)
0:57.826 default H demonbolt Fluffy_Pillow 93369.0/100000: 93% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(3), vilefiend, quick_navigation(2), archive_of_the_titans(12)
0:59.086 default H demonbolt Fluffy_Pillow 92629.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(4), vilefiend, quick_navigation(2), archive_of_the_titans(12)
1:00.347 default G hand_of_guldan Fluffy_Pillow 91890.0/100000: 92% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), vilefiend, quick_navigation(2), archive_of_the_titans(13)
1:01.607 build_a_shard J shadow_bolt Fluffy_Pillow 93150.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(7), vilefiend, quick_navigation(2), archive_of_the_titans(13)
1:03.288 build_a_shard J shadow_bolt Fluffy_Pillow 92831.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(8), vilefiend, quick_navigation(2), archive_of_the_titans(13)
1:04.967 default E call_dreadstalkers Fluffy_Pillow 92510.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), quick_navigation(2), archive_of_the_titans(13)
1:06.228 build_a_shard J shadow_bolt Fluffy_Pillow 93771.0/100000: 94% mana | 2.0/5: 40% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(14)
1:07.908 default G hand_of_guldan Fluffy_Pillow 93451.0/100000: 93% mana | 3.0/5: 60% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(14)
1:09.169 build_a_shard J shadow_bolt Fluffy_Pillow 94712.0/100000: 95% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(14)
1:10.849 build_a_shard J shadow_bolt Fluffy_Pillow 94392.0/100000: 94% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(15)
1:12.530 default H demonbolt Fluffy_Pillow 94073.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(15)
1:13.791 default G hand_of_guldan Fluffy_Pillow 93334.0/100000: 93% mana | 4.0/5: 80% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(15)
1:15.051 build_a_shard J shadow_bolt Fluffy_Pillow 94594.0/100000: 95% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(16)
1:16.720 build_a_shard J shadow_bolt Fluffy_Pillow 94263.0/100000: 94% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(16)
1:18.388 default G hand_of_guldan Fluffy_Pillow 93931.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(7), quick_navigation(3), archive_of_the_titans(16)
1:19.641 build_a_shard J shadow_bolt Fluffy_Pillow 95184.0/100000: 95% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(4), quick_navigation(3), archive_of_the_titans(16)
1:21.310 build_a_shard J shadow_bolt Fluffy_Pillow 94853.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation(3), archive_of_the_titans(17)
1:22.980 build_a_shard J shadow_bolt Fluffy_Pillow 94523.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation(3), archive_of_the_titans(17)
1:24.649 build_a_shard J shadow_bolt Fluffy_Pillow 94192.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation(3), archive_of_the_titans(17)
1:26.319 build_a_shard J shadow_bolt Fluffy_Pillow 93862.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation(3), archive_of_the_titans(18)
1:27.987 default G hand_of_guldan Fluffy_Pillow 93530.0/100000: 94% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation(3), archive_of_the_titans(18)
1:29.241 default H demonbolt Fluffy_Pillow 94784.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(3), archive_of_the_titans(18)
1:30.492 default E call_dreadstalkers Fluffy_Pillow 94035.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(2), quick_navigation(3), archive_of_the_titans(19)
1:31.745 default H demonbolt Fluffy_Pillow 95288.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(19)
1:32.996 default G hand_of_guldan Fluffy_Pillow 94539.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(19)
1:34.248 default D summon_vilefiend Fluffy_Pillow 95791.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(19)
1:35.908 build_a_shard J shadow_bolt Fluffy_Pillow 97451.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
1:37.566 build_a_shard J shadow_bolt Fluffy_Pillow 97109.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
1:39.225 default F summon_demonic_tyrant Fluffy_Pillow 96768.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
1:40.883 default 8 potion Fluffy_Pillow 96426.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20)
1:40.883 default G hand_of_guldan Fluffy_Pillow 96426.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:42.128 build_a_shard J shadow_bolt Fluffy_Pillow 97671.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:43.787 build_a_shard J shadow_bolt Fluffy_Pillow 97330.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:45.371 build_a_shard J shadow_bolt Fluffy_Pillow 96914.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:46.952 build_a_shard J shadow_bolt Fluffy_Pillow 96495.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:48.535 build_a_shard J shadow_bolt Fluffy_Pillow 96078.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:50.118 default G hand_of_guldan Fluffy_Pillow 95661.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:51.305 default E call_dreadstalkers Fluffy_Pillow 96848.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(25), archive_of_the_titans(20), battle_potion_of_intellect
1:52.343 build_a_shard J shadow_bolt Fluffy_Pillow 97886.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(8), dreadstalkers(4), vilefiend, tyrant, quick_navigation_final, overwhelming_power(24), archive_of_the_titans(20), battle_potion_of_intellect
1:53.731 build_a_shard J shadow_bolt Fluffy_Pillow 97274.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(11), dreadstalkers(4), vilefiend, tyrant, quick_navigation_final, overwhelming_power(23), archive_of_the_titans(20), battle_potion_of_intellect
1:55.126 default G hand_of_guldan Fluffy_Pillow 96669.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(11), dreadstalkers(4), vilefiend, tyrant, overwhelming_power(21), archive_of_the_titans(20), battle_potion_of_intellect
1:56.254 default H demonbolt Fluffy_Pillow 97797.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, overwhelming_power(20), archive_of_the_titans(20), battle_potion_of_intellect
1:57.388 build_a_shard J shadow_bolt Fluffy_Pillow 96931.0/100000: 97% mana | 2.0/5: 40% soul_shard supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, overwhelming_power(19), archive_of_the_titans(20), battle_potion_of_intellect
1:58.909 default G hand_of_guldan Fluffy_Pillow 96452.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core(2), supreme_commander, wild_imps(12), dreadstalkers(2), vilefiend, overwhelming_power(18), archive_of_the_titans(20), battle_potion_of_intellect
2:00.058 default H demonbolt Fluffy_Pillow 97601.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, overwhelming_power(16), archive_of_the_titans(20), battle_potion_of_intellect
2:01.217 default H demonbolt Fluffy_Pillow 96760.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core, supreme_commander, wild_imps(12), dreadstalkers(2), vilefiend, overwhelming_power(15), archive_of_the_titans(20), battle_potion_of_intellect
2:02.385 default G hand_of_guldan Fluffy_Pillow 95928.0/100000: 96% mana | 4.0/5: 80% soul_shard supreme_commander, wild_imps(12), dreadstalkers(2), vilefiend, overwhelming_power(14), archive_of_the_titans(20), battle_potion_of_intellect
2:03.560 default H demonbolt Fluffy_Pillow 97103.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core(3), supreme_commander, wild_imps(7), vilefiend, overwhelming_power(13), archive_of_the_titans(20), battle_potion_of_intellect
2:04.742 default G hand_of_guldan Fluffy_Pillow 96285.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(8), vilefiend, overwhelming_power(12), archive_of_the_titans(20), battle_potion_of_intellect
2:05.929 default H demonbolt Fluffy_Pillow 97472.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(7), overwhelming_power(11), archive_of_the_titans(20)
2:07.123 default H demonbolt Fluffy_Pillow 96666.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(8), overwhelming_power(9), archive_of_the_titans(20)
2:08.331 build_a_shard J shadow_bolt Fluffy_Pillow 95874.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_calling, supreme_commander, wild_imps(9), overwhelming_power(8), archive_of_the_titans(20)
2:09.950 default G hand_of_guldan Fluffy_Pillow 95493.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_calling, supreme_commander, wild_imps(6), overwhelming_power(7), archive_of_the_titans(20)
2:11.173 default E call_dreadstalkers Fluffy_Pillow 96716.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), overwhelming_power(5), archive_of_the_titans(20)
2:12.541 build_a_shard J shadow_bolt Fluffy_Pillow 98084.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(8), dreadstalkers(2), overwhelming_power(4), archive_of_the_titans(20)
2:14.201 build_a_shard J shadow_bolt Fluffy_Pillow 97744.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation, overwhelming_power(2), archive_of_the_titans(20)
2:15.871 default G hand_of_guldan Fluffy_Pillow 97414.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation(2), overwhelming_power, archive_of_the_titans(20)
2:17.124 build_a_shard J shadow_bolt Fluffy_Pillow 98667.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:18.803 build_a_shard J shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:20.482 build_a_shard J shadow_bolt Fluffy_Pillow 97683.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:22.162 default D summon_vilefiend Fluffy_Pillow 97363.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:23.843 default H demonbolt Fluffy_Pillow 99044.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(3), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:25.103 default G hand_of_guldan Fluffy_Pillow 98304.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(4), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:26.364 default H demonbolt Fluffy_Pillow 99565.0/100000: 100% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(4), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:27.623 build_a_shard J shadow_bolt Fluffy_Pillow 98824.0/100000: 99% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:29.302 build_a_shard J shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(4), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:30.982 default G hand_of_guldan Fluffy_Pillow 97684.0/100000: 98% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(4), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:32.244 default E call_dreadstalkers Fluffy_Pillow 98946.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:33.503 build_a_shard J shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:35.182 build_a_shard J shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:36.863 default G hand_of_guldan Fluffy_Pillow 97685.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:38.123 default H demonbolt Fluffy_Pillow 98945.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:39.383 build_a_shard J shadow_bolt Fluffy_Pillow 98205.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:41.065 build_a_shard J shadow_bolt Fluffy_Pillow 97887.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
2:42.735 build_a_shard J shadow_bolt Fluffy_Pillow 97557.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
2:44.395 nether_portal_building Y hand_of_guldan Fluffy_Pillow 97217.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(4), archive_of_the_titans(20)
2:45.641 build_a_shard J shadow_bolt Fluffy_Pillow 98463.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(4), archive_of_the_titans(20)
2:47.300 build_a_shard J shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation(4), archive_of_the_titans(20)
2:48.960 build_a_shard J shadow_bolt Fluffy_Pillow 97664.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation(4), archive_of_the_titans(20)
2:50.619 nether_portal_building Y hand_of_guldan Fluffy_Pillow 97323.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation_final, archive_of_the_titans(20)
2:51.808 build_a_shard J shadow_bolt Fluffy_Pillow 98512.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation_final, archive_of_the_titans(20)
2:53.390 nether_portal_building W call_dreadstalkers Fluffy_Pillow 98004.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation_final, archive_of_the_titans(20)
2:54.577 build_a_shard J shadow_bolt Fluffy_Pillow 99191.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(7), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:56.159 build_a_shard J shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:57.741 build_a_shard J shadow_bolt Fluffy_Pillow 97586.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:59.323 nether_portal_building Y hand_of_guldan Fluffy_Pillow 97168.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
3:00.510 build_a_shard J shadow_bolt Fluffy_Pillow 98355.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(4), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
3:02.093 build_a_shard J shadow_bolt Fluffy_Pillow 97938.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
3:03.784 build_a_shard J shadow_bolt Fluffy_Pillow 97629.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(4), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
3:05.463 nether_portal_building V nether_portal Fluffy_Pillow 97308.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation(2), archive_of_the_titans(20)
3:06.723 nether_portal_active Q hand_of_guldan Fluffy_Pillow 98568.0/100000: 99% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(4), portal_summons, quick_navigation(2), archive_of_the_titans(20)
3:07.985 nether_portal_active Q hand_of_guldan Fluffy_Pillow 99830.0/100000: 100% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(4), portal_summons(2), quick_navigation(2), archive_of_the_titans(20)
3:09.245 nether_portal_active T demonbolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(4), portal_summons(3), quick_navigation(2), archive_of_the_titans(20)
3:10.504 nether_portal_active N summon_vilefiend Fluffy_Pillow 99259.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, nether_portal, wild_imps(5), portal_summons(3), quick_navigation(2), archive_of_the_titans(20)
3:12.185 build_a_shard J shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, nether_portal, wild_imps(6), vilefiend, portal_summons(4), quick_navigation(3), archive_of_the_titans(20)
3:13.853 nether_portal_active O call_dreadstalkers Fluffy_Pillow 98003.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, nether_portal, wild_imps(6), vilefiend, portal_summons(4), quick_navigation(3), archive_of_the_titans(20)
3:15.105 nether_portal_active Q hand_of_guldan Fluffy_Pillow 99255.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, portal_summons(5), quick_navigation(3), archive_of_the_titans(20)
3:16.356 nether_portal_active R summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, portal_summons(6), quick_navigation(3), archive_of_the_titans(20)
3:18.026 default 9 use_items Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation(3), archive_of_the_titans(20)
3:18.026 default A berserking Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse
3:18.026 nether_portal_active T demonbolt Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_core, demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse
3:19.081 nether_portal_active Q hand_of_guldan Fluffy_Pillow 97060.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse
3:20.134 build_a_shard J shadow_bolt Fluffy_Pillow 98113.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_power, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse
3:21.539 nether_portal_active Q hand_of_guldan Fluffy_Pillow 97518.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse
3:22.596 build_a_shard J shadow_bolt Fluffy_Pillow 98575.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse(2)
3:23.955 nether_portal_active Q hand_of_guldan Fluffy_Pillow 97934.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse(2)
3:24.977 build_a_shard J shadow_bolt Fluffy_Pillow 98956.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse(2)
3:26.331 build_a_shard J shadow_bolt Fluffy_Pillow 98006.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation_final, overwhelming_power(25), archive_of_the_titans(20), ignition_mages_fuse(3)
3:27.439 build_a_shard J shadow_bolt Fluffy_Pillow 97114.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation_final, overwhelming_power(24), archive_of_the_titans(20), ignition_mages_fuse(3)
3:28.554 default G hand_of_guldan Fluffy_Pillow 96229.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation_final, overwhelming_power(23), archive_of_the_titans(20), ignition_mages_fuse(3)
3:29.521 build_a_shard J shadow_bolt Fluffy_Pillow 97196.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation_final, overwhelming_power(22), archive_of_the_titans(20), ignition_mages_fuse(3)
3:30.815 build_a_shard J shadow_bolt Fluffy_Pillow 96490.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation_final, overwhelming_power(21), archive_of_the_titans(20), ignition_mages_fuse(4)
3:32.082 build_a_shard J shadow_bolt Fluffy_Pillow 95757.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation_final, overwhelming_power(19), archive_of_the_titans(20), ignition_mages_fuse(4)
3:33.360 default H demonbolt Fluffy_Pillow 95035.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(10), dreadstalkers(2), vilefiend, portal_summons(7), quick_navigation_final, overwhelming_power(18), archive_of_the_titans(20), ignition_mages_fuse(4)
3:34.326 default E call_dreadstalkers Fluffy_Pillow 94001.0/100000: 94% mana | 5.0/5: 100% soul_shard demonic_calling, supreme_commander, wild_imps(10), dreadstalkers(2), vilefiend, portal_summons(7), quick_navigation_final, overwhelming_power(17), archive_of_the_titans(20), ignition_mages_fuse(5)
3:35.271 default G hand_of_guldan Fluffy_Pillow 94946.0/100000: 95% mana | 4.0/5: 80% soul_shard supreme_commander, wild_imps(9), dreadstalkers(4), vilefiend, quick_navigation_final, overwhelming_power(16), archive_of_the_titans(20), ignition_mages_fuse(5)
3:36.220 build_a_shard J shadow_bolt Fluffy_Pillow 95895.0/100000: 96% mana | 1.0/5: 20% soul_shard supreme_commander, wild_imps(10), dreadstalkers(4), vilefiend, quick_navigation_final, overwhelming_power(15), archive_of_the_titans(20), ignition_mages_fuse(5)
3:37.490 build_a_shard J shadow_bolt Fluffy_Pillow 95165.0/100000: 95% mana | 2.0/5: 40% soul_shard supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, overwhelming_power(14), archive_of_the_titans(20), ignition_mages_fuse(5)
3:38.843 default G hand_of_guldan Fluffy_Pillow 94518.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_calling, supreme_commander, wild_imps(8), dreadstalkers(4), vilefiend, overwhelming_power(13), archive_of_the_titans(20)
3:40.024 default H demonbolt Fluffy_Pillow 95699.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(4), dreadstalkers(4), vilefiend, overwhelming_power(11), archive_of_the_titans(20)
3:41.219 default H demonbolt Fluffy_Pillow 94894.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(5), dreadstalkers(2), vilefiend, overwhelming_power(10), archive_of_the_titans(20)
3:42.421 default G hand_of_guldan Fluffy_Pillow 94096.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), overwhelming_power(9), archive_of_the_titans(20)
3:43.631 default H demonbolt Fluffy_Pillow 95306.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), overwhelming_power(25), archive_of_the_titans(20)
3:44.736 default G hand_of_guldan Fluffy_Pillow 94411.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), overwhelming_power(24), archive_of_the_titans(20)
3:45.847 default H demonbolt Fluffy_Pillow 95522.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), overwhelming_power(25), archive_of_the_titans(20)
3:46.951 default H demonbolt Fluffy_Pillow 94626.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(6), overwhelming_power(24), archive_of_the_titans(20)
3:48.062 default G hand_of_guldan Fluffy_Pillow 93737.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(10), quick_navigation, overwhelming_power(22), archive_of_the_titans(20)
3:49.180 default H demonbolt Fluffy_Pillow 94855.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(8), quick_navigation(2), overwhelming_power(21), archive_of_the_titans(20)
3:50.297 default G hand_of_guldan Fluffy_Pillow 93972.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(7), quick_navigation(2), overwhelming_power(20), archive_of_the_titans(20)
3:51.421 default H demonbolt Fluffy_Pillow 95096.0/100000: 95% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(10), quick_navigation(3), overwhelming_power(19), archive_of_the_titans(20)
3:52.546 build_a_shard J shadow_bolt Fluffy_Pillow 94221.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(9), quick_navigation(3), overwhelming_power(18), archive_of_the_titans(20)
3:54.051 build_a_shard J shadow_bolt Fluffy_Pillow 93726.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(10), quick_navigation(4), overwhelming_power(16), archive_of_the_titans(20)
3:55.563 default E call_dreadstalkers Fluffy_Pillow 93238.0/100000: 93% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), quick_navigation(4), overwhelming_power(15), archive_of_the_titans(20)
3:56.705 build_a_shard J shadow_bolt Fluffy_Pillow 94380.0/100000: 94% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(4), overwhelming_power(14), archive_of_the_titans(20)
3:58.235 default D summon_vilefiend Fluffy_Pillow 93910.0/100000: 94% mana | 4.0/5: 80% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(4), overwhelming_power(12), archive_of_the_titans(20)
3:59.781 default G hand_of_guldan Fluffy_Pillow 95456.0/100000: 95% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(11), archive_of_the_titans(20)
4:00.947 build_a_shard J shadow_bolt Fluffy_Pillow 96622.0/100000: 97% mana | 0.0/5: 0% soul_shard wild_imps(2), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(10), archive_of_the_titans(20)
4:02.513 default H demonbolt Fluffy_Pillow 96188.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(8), archive_of_the_titans(20)
4:03.699 default G hand_of_guldan Fluffy_Pillow 95374.0/100000: 95% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(7), archive_of_the_titans(20)
4:04.893 build_a_shard J shadow_bolt Fluffy_Pillow 96568.0/100000: 97% mana | 0.0/5: 0% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(6), archive_of_the_titans(20)
4:06.493 build_a_shard J shadow_bolt Fluffy_Pillow 96168.0/100000: 96% mana | 1.0/5: 20% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(4), archive_of_the_titans(20)
4:08.112 default H demonbolt Fluffy_Pillow 95787.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(6), vilefiend, quick_navigation(4), overwhelming_power(2), archive_of_the_titans(20)
4:09.342 default G hand_of_guldan Fluffy_Pillow 95017.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(6), vilefiend, quick_navigation(4), overwhelming_power, archive_of_the_titans(20)
4:10.579 default H demonbolt Fluffy_Pillow 96254.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(4), vilefiend, quick_navigation_final, archive_of_the_titans(20)
4:11.765 default H demonbolt Fluffy_Pillow 95440.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(4), vilefiend, quick_navigation_final, archive_of_the_titans(20)
4:12.954 default G hand_of_guldan Fluffy_Pillow 94629.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(7), vilefiend, quick_navigation_final, archive_of_the_titans(20)
4:14.142 build_a_shard J shadow_bolt Fluffy_Pillow 95817.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation_final, archive_of_the_titans(20)
4:15.724 default E call_dreadstalkers Fluffy_Pillow 95399.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), quick_navigation_final, archive_of_the_titans(20)
4:16.911 build_a_shard J shadow_bolt Fluffy_Pillow 96586.0/100000: 97% mana | 2.0/5: 40% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:18.494 default G hand_of_guldan Fluffy_Pillow 96169.0/100000: 96% mana | 3.0/5: 60% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:19.681 build_a_shard J shadow_bolt Fluffy_Pillow 97356.0/100000: 97% mana | 0.0/5: 0% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:21.264 default H demonbolt Fluffy_Pillow 96939.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(5), dreadstalkers(2), archive_of_the_titans(20)
4:22.541 default G hand_of_guldan Fluffy_Pillow 96216.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), archive_of_the_titans(20)
4:23.817 default H demonbolt Fluffy_Pillow 97492.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(4), dreadstalkers(2), archive_of_the_titans(20)
4:25.093 default H demonbolt Fluffy_Pillow 96768.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(5), dreadstalkers(2), archive_of_the_titans(20)
4:26.370 default G hand_of_guldan Fluffy_Pillow 96045.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), archive_of_the_titans(20)
4:27.646 build_a_shard J shadow_bolt Fluffy_Pillow 97321.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), archive_of_the_titans(20)
4:29.346 build_a_shard J shadow_bolt Fluffy_Pillow 97021.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(8), archive_of_the_titans(20)
4:31.046 default G hand_of_guldan Fluffy_Pillow 96721.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(7), quick_navigation, archive_of_the_titans(20)
4:32.314 build_a_shard J shadow_bolt Fluffy_Pillow 97989.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(7), quick_navigation, archive_of_the_titans(20)
4:34.002 build_a_shard J shadow_bolt Fluffy_Pillow 97677.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation, archive_of_the_titans(20)
4:35.691 default H demonbolt Fluffy_Pillow 97366.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation, archive_of_the_titans(20)
4:36.959 build_a_shard J shadow_bolt Fluffy_Pillow 96634.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(7), quick_navigation, archive_of_the_titans(20)
4:38.649 default G hand_of_guldan Fluffy_Pillow 96324.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(4), quick_navigation, archive_of_the_titans(20)
4:39.919 default E call_dreadstalkers Fluffy_Pillow 97594.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(4), quick_navigation, archive_of_the_titans(20)
4:41.188 default H demonbolt Fluffy_Pillow 98863.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(5), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:42.456 default H demonbolt Fluffy_Pillow 98131.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
4:43.716 default G hand_of_guldan Fluffy_Pillow 97391.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
4:44.977 default D summon_vilefiend Fluffy_Pillow 98652.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
4:46.656 build_a_shard J shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
4:48.336 default F summon_demonic_tyrant Fluffy_Pillow 98005.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
4:50.013 build_a_shard J shadow_bolt Fluffy_Pillow 97682.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20)
4:51.692 default G hand_of_guldan Fluffy_Pillow 97361.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20)
4:52.943 build_a_shard J shadow_bolt Fluffy_Pillow 98612.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20)
4:54.615 build_a_shard J shadow_bolt Fluffy_Pillow 98007.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20)
4:56.285 build_a_shard J shadow_bolt Fluffy_Pillow 97677.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20)
4:57.954 build_a_shard J shadow_bolt Fluffy_Pillow 97346.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20)
4:59.625 build_a_shard J shadow_bolt Fluffy_Pillow 97017.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 9026 8206 7205
Intellect 1467 -3 8475 7287 5476 (377)
Spirit 0 0 0 0 0
Health 180520 164120 0
Mana 100000 100000 0
Soul Shard 5 5 0
Spell Power 8475 7287 0
Crit 17.68% 17.68% 913
Haste 17.90% 17.90% 1217
Damage / Heal Versatility 1.52% 1.52% 129
ManaReg per Second 1000 1000 0
Mastery 26.55% 26.55% 742
Armor 1159 1159 1159
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Horrific Amalgam's Hood
ilevel: 390, stats: { 154 Armor, +655 Int, +1189 Sta }
azerite powers: { Supreme Commander, Overwhelming Power, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Amice of Corrupting Horror
ilevel: 390, stats: { 142 Armor, +491 Int, +892 Sta }
azerite powers: { Archive of the Titans, Heed My Call, Azerite Empowered }
Local Chest Robes of the Unraveler
ilevel: 390, stats: { 189 Armor, +655 Int, +1189 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Azerite Empowered }
Local Waist Cord of Septic Envelopment
ilevel: 385, stats: { 103 Armor, +247 Int, +417 Sta, +115 Haste, +68 Crit }
Local Legs Leggings of Lingering Infestation
ilevel: 385, stats: { 160 Armor, +329 Int, +556 Sta, +133 Haste, +112 Mastery }
Local Feet Volatile Walkers
ilevel: 385, stats: { 126 Armor, +247 Int, +417 Sta, +111 Crit, +72 Vers }
Local Wrists Void-Lashed Wristband
ilevel: 385, stats: { 80 Armor, +185 Int, +312 Sta, +81 Mastery, +57 Vers }
Local Hands Mutagenic Protofluid Handwraps
ilevel: 385, stats: { 114 Armor, +247 Int, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 370, stats: { +271 Int }
Local Trinket2 Vigilant's Bloodshaper
ilevel: 385, stats: { +313 Int }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Tusk of the Reborn Prophet
ilevel: 385, weapon: { 126 - 211, 1.8 }, stats: { +164 Int, +277 Sta, +70 Crit, +51 Haste, +792 Int }, enchant: quick_navigation
Local Off Hand Codex of Imminent Ruin
ilevel: 385, stats: { +277 Sta, +66 Haste, +56 Mastery, +503 Int }

Talents

Level
15 Dreadlash (Demonology Warlock) Demonic Strength (Demonology Warlock) Bilescourge Bombers (Demonology Warlock)
30 Demonic Calling (Demonology Warlock) Power Siphon (Demonology Warlock) Doom (Demonology Warlock)
45 Demon Skin Burning Rush Dark Pact
60 From the Shadows (Demonology Warlock) Soul Strike (Demonology Warlock) Summon Vilefiend (Demonology Warlock)
75 Darkfury Mortal Coil Demonic Circle
90 Soul Conduit (Demonology Warlock) Inner Demons (Demonology Warlock) Grimoire: Felguard (Demonology Warlock)
100 Sacrificed Souls (Demonology Warlock) Demonic Consumption (Demonology Warlock) Nether Portal (Demonology Warlock)

Profile

warlock="DStr_ID_Imp"
source=default
spec=demonology
level=120
race=troll
role=spell
position=ranged_back
talents=2103023

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/inner_demons,if=talent.inner_demons.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/demonbolt

# Executed every time the actor is available.
actions=potion,if=pet.demonic_tyrant.active|target.time_to_die<30
actions+=/use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
actions+=/demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
actions+=/call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
actions+=/call_action_list,name=implosion,if=spell_targets.implosion>1
actions+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions+=/summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions+=/call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions+=/summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
actions+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
actions+=/doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
actions+=/hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
actions+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
actions+=/bilescourge_bombers
actions+=/call_action_list,name=build_a_shard

actions.build_a_shard=demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
actions.build_a_shard+=/soul_strike
actions.build_a_shard+=/shadow_bolt

actions.implosion=implosion,if=(buff.wild_imps.stack>=6&(soul_shard<3|prev_gcd.1.call_dreadstalkers|buff.wild_imps.stack>=9|prev_gcd.1.bilescourge_bombers|(!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan))&!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan&buff.demonic_power.down)|(time_to_die<3&buff.wild_imps.stack>0)|(prev_gcd.2.call_dreadstalkers&buff.wild_imps.stack>2&!talent.demonic_calling.enabled)
actions.implosion+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.implosion+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.implosion+=/summon_demonic_tyrant
actions.implosion+=/hand_of_guldan,if=soul_shard>=5
actions.implosion+=/hand_of_guldan,if=soul_shard>=3&(((prev_gcd.2.hand_of_guldan|buff.wild_imps.stack>=3)&buff.wild_imps.stack<9)|cooldown.summon_demonic_tyrant.remains<=gcd*2|buff.demonic_power.remains>gcd*2)
actions.implosion+=/demonbolt,if=prev_gcd.1.hand_of_guldan&soul_shard>=1&(buff.wild_imps.stack<=3|prev_gcd.3.hand_of_guldan)&soul_shard<4&buff.demonic_core.up
actions.implosion+=/summon_vilefiend,if=(cooldown.summon_demonic_tyrant.remains>40&spell_targets.implosion<=2)|cooldown.summon_demonic_tyrant.remains<12
actions.implosion+=/bilescourge_bombers,if=cooldown.summon_demonic_tyrant.remains>9
actions.implosion+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions.implosion+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&(buff.demonic_core.stack>=3|buff.demonic_core.remains<=gcd*5.7)
actions.implosion+=/doom,cycle_targets=1,max_cycle_targets=7,if=refreshable
actions.implosion+=/call_action_list,name=build_a_shard

actions.nether_portal=call_action_list,name=nether_portal_building,if=cooldown.nether_portal.remains<20
actions.nether_portal+=/call_action_list,name=nether_portal_active,if=cooldown.nether_portal.remains>160

actions.nether_portal_active=grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.nether_portal_active+=/summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions.nether_portal_active+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.nether_portal_active+=/call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
actions.nether_portal_active+=/hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
actions.nether_portal_active+=/demonbolt,if=buff.demonic_core.up
actions.nether_portal_active+=/call_action_list,name=build_a_shard

actions.nether_portal_building=nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
actions.nether_portal_building+=/call_dreadstalkers
actions.nether_portal_building+=/hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
actions.nether_portal_building+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
actions.nether_portal_building+=/hand_of_guldan,if=soul_shard>=5
actions.nether_portal_building+=/call_action_list,name=build_a_shard

head=horrific_amalgams_hood,id=160616,bonus_id=4824/1507/4775,azerite_powers=458/30/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536,azerite_level=33
shoulders=amice_of_corrupting_horror,id=160726,bonus_id=4824/1507/4775,azerite_powers=483/22/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=robes_of_the_unraveler,id=160614,bonus_id=4824/1507/4775,azerite_powers=483/30/13
wrists=voidlashed_wristband,id=160617,bonus_id=4800/1507
hands=mutagenic_protofluid_handwraps,id=160715,bonus_id=4800/1507
waist=cord_of_septic_envelopment,id=160727,bonus_id=4800/1507
legs=leggings_of_lingering_infestation,id=160615,bonus_id=4800/1507
feet=volatile_walkers,id=160714,bonus_id=4800/1507
finger1=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=ignition_mages_fuse,id=159615,bonus_id=1542/4779
trinket2=vigilants_bloodshaper,id=160651,bonus_id=4800/1507
main_hand=tusk_of_the_reborn_prophet,id=160691,bonus_id=4800/1507,enchant=quick_navigation
off_hand=codex_of_imminent_ruin,id=160696,bonus_id=4800/1507

# Gear Summary
# gear_ilvl=385.25
# gear_stamina=7205
# gear_intellect=5476
# gear_crit_rating=913
# gear_haste_rating=1217
# gear_mastery_rating=742
# gear_versatility_rating=129
# gear_armor=1159
default_pet=Imp

Simulation & Raid Information

Iterations: 5003
Threads: 4
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 257583272
Max Event Queue: 1018
Sim Seconds: 1500833
CPU Seconds: 587.9219
Physical Seconds: 172.9934
Speed Up: 2553

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
DL_GF_Felguard DL_GF_Felguard augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_GF_Felguard DL_GF_Felguard berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.28sec 0 299.99sec
DL_GF_Felguard DL_GF_Felguard call_dreadstalkers 104316 0 0 0.00 0 0 14.6 0.0 0.0% 0.0% 0.0% 0.0% 20.93sec 0 299.99sec
DL_GF_Felguard DL_GF_Felguard demonbolt 264178 376551 1255 9.01 7109 14220 44.2 45.0 17.6% 0.0% 0.0% 0.0% 6.20sec 376551 299.99sec
DL_GF_Felguard DL_GF_Felguard flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_GF_Felguard DL_GF_Felguard food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_GF_Felguard DL_GF_Felguard grimoire_felguard 111898 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.76sec 0 299.99sec
DL_GF_Felguard DL_GF_Felguard hand_of_guldan 105174 315645 1052 12.06 4450 8892 60.4 60.3 17.7% 0.0% 0.0% 0.0% 4.90sec 315645 299.99sec
DL_GF_Felguard DL_GF_Felguard heed_my_call 271685 41926 140 1.45 4925 9849 7.2 7.2 17.7% 0.0% 0.0% 0.0% 36.76sec 41926 299.99sec
DL_GF_Felguard DL_GF_Felguard heed_my_call_aoe 271686 17985 60 1.45 2111 4221 7.2 7.2 17.9% 0.0% 0.0% 0.0% 36.76sec 17985 299.99sec
DL_GF_Felguard DL_GF_Felguard nether_portal 267217 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_GF_Felguard DL_GF_Felguard potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_GF_Felguard DL_GF_Felguard shadow_bolt 686 401701 1339 18.99 3595 7188 95.7 95.0 17.7% 0.0% 0.0% 0.0% 3.06sec 401701 299.99sec
DL_GF_Felguard DL_GF_Felguard summon_demonic_tyrant 265187 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.54sec 0 299.99sec
DL_GF_Felguard DL_GF_Felguard summon_felguard 30146 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_GF_Felguard DL_GF_Felguard summon_random_demon 0 0 0 0.00 0 0 15.1 0.0 0.0% 0.0% 0.0% 0.0% 14.69sec 0 299.99sec
DL_GF_Felguard DL_GF_Felguard summon_vilefiend 264119 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 47.23sec 0 299.99sec
DL_GF_Felguard DL_GF_Felguard volatile_blood_explosion 278057 86154 287 1.43 10240 20481 7.3 7.2 17.4% 0.0% 0.0% 0.0% 36.77sec 86154 299.99sec
DL_GF_Felguard DL_GF_Felguard_felguard felstorm ticks -89751 113546 378 12.42 1553 3106 10.4 62.1 17.8% 0.0% 0.0% 0.0% 30.14sec 162328 299.99sec
DL_GF_Felguard DL_GF_Felguard_felguard legion_strike 30213 317945 1060 11.68 4626 9247 58.4 58.4 17.7% 0.0% 0.0% 0.0% 5.10sec 454541 299.99sec
DL_GF_Felguard DL_GF_Felguard_felguard melee 0 358541 1195 34.72 1756 3513 173.6 173.6 17.6% 0.0% 0.0% 0.0% 1.71sec 512577 299.99sec
DL_GF_Felguard DL_GF_Felguard_grimoire_felguard axe_toss 89766 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 80.23sec 0 64.40sec
DL_GF_Felguard DL_GF_Felguard_grimoire_felguard felstorm ticks -89751 45641 152 3.89 1988 3978 3.9 19.5 17.9% 0.0% 0.0% 0.0% 80.87sec 65249 64.40sec
DL_GF_Felguard DL_GF_Felguard_grimoire_felguard legion_strike 30213 129069 2004 17.16 5953 11907 18.4 18.4 17.7% 0.0% 0.0% 0.0% 13.87sec 184520 64.40sec
DL_GF_Felguard DL_GF_Felguard_grimoire_felguard melee 0 109776 1705 38.10 2280 4560 40.9 40.9 17.7% 0.0% 0.0% 0.0% 6.38sec 156938 64.40sec
DL_GF_Felguard DL_GF_Felguard_shivarra melee 0 32683 2712 208.14 665 1331 41.8 41.8 17.6% 0.0% 0.0% 0.0% 2.58sec 46725 12.05sec
DL_GF_Felguard DL_GF_Felguard_shivarra melee_oh 0 16367 1358 208.14 333 665 41.8 41.8 17.7% 0.0% 0.0% 0.0% 2.58sec 23399 12.05sec
DL_GF_Felguard DL_GF_Felguard_shivarra multislash 272172 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 12.05sec
DL_GF_Felguard DL_GF_Felguard_shivarra multislash1 272172 6693 555 33.58 844 1689 6.7 6.7 17.5% 0.0% 0.0% 0.0% 17.20sec 9568 12.05sec
DL_GF_Felguard DL_GF_Felguard_shivarra multislash2 272172 6693 555 33.58 844 1689 6.7 6.7 17.6% 0.0% 0.0% 0.0% 17.20sec 9569 12.05sec
DL_GF_Felguard DL_GF_Felguard_shivarra multislash3 272172 6685 555 33.58 844 1686 6.7 6.7 17.4% 0.0% 0.0% 0.0% 17.20sec 9556 12.05sec
DL_GF_Felguard DL_GF_Felguard_shivarra multislash4 272172 6693 555 33.58 844 1689 6.7 6.7 17.5% 0.0% 0.0% 0.0% 17.20sec 9568 12.05sec
DL_GF_Felguard DL_GF_Felguard_illidari_satyr melee 0 16749 1513 232.09 332 665 42.8 42.8 17.7% 0.0% 0.0% 0.0% 2.60sec 23944 11.07sec
DL_GF_Felguard DL_GF_Felguard_illidari_satyr melee_oh 0 8370 756 232.09 166 332 42.8 42.8 17.6% 0.0% 0.0% 0.0% 2.60sec 11966 11.07sec
DL_GF_Felguard DL_GF_Felguard_illidari_satyr shadow_slash 272012 25816 2332 49.66 2395 4789 9.2 9.2 17.6% 0.0% 0.0% 0.0% 12.50sec 25816 11.07sec
DL_GF_Felguard DL_GF_Felguard_vilefiend bile_spit 267997 71213 502 2.86 8930 17867 6.8 6.8 17.8% 0.0% 0.0% 0.0% 47.23sec 164818 141.96sec
DL_GF_Felguard DL_GF_Felguard_vilefiend bile_spit ticks -267997 93605 312 6.63 2822 0 6.8 33.2 0.0% 0.0% 0.0% 0.0% 47.23sec 164818 141.96sec
DL_GF_Felguard DL_GF_Felguard_vilefiend headbutt 267999 104102 733 12.05 3106 6210 28.5 28.5 17.6% 0.0% 0.0% 0.0% 10.27sec 148826 141.96sec
DL_GF_Felguard DL_GF_Felguard_vilefiend melee 0 185054 1304 43.41 1531 3061 102.7 102.7 17.7% 0.0% 0.0% 0.0% 2.82sec 264558 141.96sec
DL_GF_Felguard DL_GF_Felguard_vicious_hellhound demon_fangs 272013 25713 2303 49.02 2392 4790 9.1 9.1 17.8% 0.0% 0.0% 0.0% 12.50sec 25713 11.16sec
DL_GF_Felguard DL_GF_Felguard_vicious_hellhound melee 0 15852 1420 434.95 166 333 80.9 80.9 17.6% 0.0% 0.0% 0.0% 1.36sec 22662 11.16sec
DL_GF_Felguard DL_GF_Felguard_dreadstalker dreadbite 205196 264176 2433 16.08 7720 15438 29.1 29.1 17.6% 0.0% 0.0% 0.0% 20.93sec 264176 108.57sec
DL_GF_Felguard DL_GF_Felguard_dreadstalker melee 0 456884 4208 172.46 1244 2488 312.1 312.1 17.7% 0.0% 0.0% 0.0% 1.89sec 653171 108.57sec
DL_GF_Felguard DL_GF_Felguard_wild_imp fel_firebolt 104318 743327 8973 718.25 637 1274 995.8 991.7 17.7% 0.0% 0.0% 0.0% 0.29sec 743327 82.84sec
DL_GF_Felguard DL_GF_Felguard_demonic_tyrant demonfire 270481 246740 4644 42.53 5561 11120 37.7 37.7 17.8% 0.0% 0.0% 0.0% 6.91sec 246740 53.13sec
DL_GF_Felguard DL_GF_Felguard_darkhound fel_bite 272435 18605 1962 55.73 1796 3594 8.8 8.8 17.6% 0.0% 0.0% 0.0% 13.28sec 26598 9.48sec
DL_GF_Felguard DL_GF_Felguard_darkhound melee 0 33018 3483 267.30 665 1330 42.2 42.2 17.5% 0.0% 0.0% 0.0% 2.67sec 47203 9.48sec
DL_GF_Felguard DL_GF_Felguard_wrathguard melee 0 33249 2519 193.34 665 1329 42.5 42.5 17.6% 0.0% 0.0% 0.0% 2.69sec 47533 13.20sec
DL_GF_Felguard DL_GF_Felguard_wrathguard melee_oh 0 16640 1261 193.34 332 665 42.5 42.5 17.7% 0.0% 0.0% 0.0% 2.69sec 23789 13.20sec
DL_GF_Felguard DL_GF_Felguard_wrathguard overhead_assault 272432 18872 1430 40.58 1794 3588 8.9 8.9 17.8% 0.0% 0.0% 0.0% 13.26sec 26979 13.20sec
DL_GF_Felguard DL_GF_Felguard_void_terror double_breath 272156 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 12.99sec
DL_GF_Felguard DL_GF_Felguard_void_terror double_breath1 272156 19719 1518 32.40 2390 4775 7.0 7.0 17.7% 0.0% 0.0% 0.0% 16.84sec 19719 12.99sec
DL_GF_Felguard DL_GF_Felguard_void_terror double_breath2 272156 19735 1519 32.40 2389 4777 7.0 7.0 17.8% 0.0% 0.0% 0.0% 16.84sec 19735 12.99sec
DL_GF_Felguard DL_GF_Felguard_void_terror melee 0 33415 2572 196.88 665 1330 42.6 42.6 17.8% 0.0% 0.0% 0.0% 2.59sec 47771 12.99sec
DL_GF_Felguard DL_GF_Felguard_bilescourge toxic_bile 272167 154334 15991 339.52 2402 4802 54.6 54.6 17.7% 0.0% 0.0% 0.0% 2.00sec 154334 9.65sec
DL_GF_Felguard DL_GF_Felguard_urzul many_faced_bite 272439 20008 1365 38.87 1792 3585 9.5 9.5 17.6% 0.0% 0.0% 0.0% 12.13sec 28604 14.65sec
DL_GF_Felguard DL_GF_Felguard_urzul melee 0 33286 2272 174.38 665 1329 42.6 42.6 17.6% 0.0% 0.0% 0.0% 2.62sec 47586 14.65sec
DL_GF_Felguard DL_GF_Felguard_eye_of_guldan eye_of_guldan ticks -272131 23976 80 11.99 400 0 27.4 59.9 0.0% 0.0% 0.0% 0.0% 5.60sec 23976 21.43sec
DL_GF_Felguard DL_GF_Felguard_prince_malchezaar melee 0 79701 4927 79.23 3152 6314 21.4 21.4 18.3% 0.0% 0.0% 0.0% 1.44sec 113943 16.18sec
DL_GF_Felguard DL_GF_Felguard_prince_malchezaar melee_oh 0 39373 2434 79.23 1576 3152 21.4 21.4 16.9% 0.0% 0.0% 0.0% 1.44sec 56289 16.18sec
DL_GF_Imp DL_GF_Imp augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_GF_Imp DL_GF_Imp berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.28sec 0 299.99sec
DL_GF_Imp DL_GF_Imp call_dreadstalkers 104316 0 0 0.00 0 0 14.6 0.0 0.0% 0.0% 0.0% 0.0% 20.93sec 0 299.99sec
DL_GF_Imp DL_GF_Imp demonbolt 264178 376632 1255 9.00 7110 14226 44.2 45.0 17.7% 0.0% 0.0% 0.0% 6.22sec 376632 299.99sec
DL_GF_Imp DL_GF_Imp flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_GF_Imp DL_GF_Imp food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_GF_Imp DL_GF_Imp grimoire_felguard 111898 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.75sec 0 299.99sec
DL_GF_Imp DL_GF_Imp hand_of_guldan 105174 315601 1052 12.06 4446 8913 60.4 60.3 17.6% 0.0% 0.0% 0.0% 4.90sec 315601 299.99sec
DL_GF_Imp DL_GF_Imp heed_my_call 271685 42003 140 1.45 4925 9849 7.3 7.3 17.6% 0.0% 0.0% 0.0% 37.18sec 42003 299.99sec
DL_GF_Imp DL_GF_Imp heed_my_call_aoe 271686 17975 60 1.45 2111 4221 7.3 7.3 17.5% 0.0% 0.0% 0.0% 37.18sec 17975 299.99sec
DL_GF_Imp DL_GF_Imp nether_portal 267217 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_GF_Imp DL_GF_Imp potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_GF_Imp DL_GF_Imp shadow_bolt 686 402375 1341 19.01 3595 7190 95.7 95.1 17.8% 0.0% 0.0% 0.0% 3.05sec 402375 299.99sec
DL_GF_Imp DL_GF_Imp summon_demonic_tyrant 265187 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.49sec 0 299.99sec
DL_GF_Imp DL_GF_Imp summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_GF_Imp DL_GF_Imp summon_random_demon 0 0 0 0.00 0 0 15.1 0.0 0.0% 0.0% 0.0% 0.0% 14.65sec 0 299.99sec
DL_GF_Imp DL_GF_Imp summon_vilefiend 264119 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 47.23sec 0 299.99sec
DL_GF_Imp DL_GF_Imp volatile_blood_explosion 278057 86076 287 1.43 10240 20481 7.2 7.1 17.7% 0.0% 0.0% 0.0% 37.25sec 86076 299.99sec
DL_GF_Imp DL_GF_Imp_imp firebolt 3110 942820 3143 20.61 7775 15558 103.9 103.0 17.7% 0.0% 0.0% 0.0% 2.89sec 942820 299.99sec
DL_GF_Imp DL_GF_Imp_grimoire_felguard axe_toss 89766 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 80.14sec 0 64.40sec
DL_GF_Imp DL_GF_Imp_grimoire_felguard felstorm ticks -89751 45566 152 3.89 1989 3977 3.9 19.5 17.6% 0.0% 0.0% 0.0% 80.74sec 65141 64.40sec
DL_GF_Imp DL_GF_Imp_grimoire_felguard legion_strike 30213 129201 2006 17.19 5955 11912 18.4 18.4 17.6% 0.0% 0.0% 0.0% 13.88sec 184708 64.40sec
DL_GF_Imp DL_GF_Imp_grimoire_felguard melee 0 109734 1704 38.15 2280 4561 41.0 41.0 17.5% 0.0% 0.0% 0.0% 6.36sec 156877 64.40sec
DL_GF_Imp DL_GF_Imp_shivarra melee 0 33296 3472 266.13 665 1329 42.5 42.5 17.8% 0.0% 0.0% 0.0% 2.71sec 47601 9.59sec
DL_GF_Imp DL_GF_Imp_shivarra melee_oh 0 16640 1735 266.13 332 665 42.5 42.5 17.7% 0.0% 0.0% 0.0% 2.71sec 23789 9.59sec
DL_GF_Imp DL_GF_Imp_shivarra multislash 272172 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 9.59sec
DL_GF_Imp DL_GF_Imp_shivarra multislash1 272172 6836 713 43.03 843 1689 6.9 6.9 17.8% 0.0% 0.0% 0.0% 18.19sec 9772 9.59sec
DL_GF_Imp DL_GF_Imp_shivarra multislash2 272172 6847 714 43.03 844 1686 6.9 6.9 18.1% 0.0% 0.0% 0.0% 18.19sec 9788 9.59sec
DL_GF_Imp DL_GF_Imp_shivarra multislash3 272172 6816 711 43.03 843 1686 6.9 6.9 17.5% 0.0% 0.0% 0.0% 18.19sec 9744 9.59sec
DL_GF_Imp DL_GF_Imp_shivarra multislash4 272172 6823 712 43.03 843 1690 6.9 6.9 17.6% 0.0% 0.0% 0.0% 18.19sec 9754 9.59sec
DL_GF_Imp DL_GF_Imp_darkhound fel_bite 272435 18803 1543 43.80 1796 3589 8.9 8.9 17.7% 0.0% 0.0% 0.0% 12.88sec 26882 12.18sec
DL_GF_Imp DL_GF_Imp_darkhound melee 0 33322 2735 209.72 665 1330 42.6 42.6 17.6% 0.0% 0.0% 0.0% 2.60sec 47638 12.18sec
DL_GF_Imp DL_GF_Imp_vilefiend bile_spit 267997 71087 501 2.86 8929 17871 6.8 6.8 17.6% 0.0% 0.0% 0.0% 47.23sec 164660 141.96sec
DL_GF_Imp DL_GF_Imp_vilefiend bile_spit ticks -267997 93572 312 6.63 2822 0 6.8 33.2 0.0% 0.0% 0.0% 0.0% 47.23sec 164660 141.96sec
DL_GF_Imp DL_GF_Imp_vilefiend headbutt 267999 104380 735 12.05 3105 6212 28.5 28.5 17.9% 0.0% 0.0% 0.0% 10.28sec 149223 141.96sec
DL_GF_Imp DL_GF_Imp_vilefiend melee 0 185053 1304 43.44 1531 3062 102.8 102.8 17.6% 0.0% 0.0% 0.0% 2.82sec 264556 141.96sec
DL_GF_Imp DL_GF_Imp_dreadstalker dreadbite 205196 264332 2455 16.21 7719 15438 29.1 29.1 17.7% 0.0% 0.0% 0.0% 20.93sec 264332 107.69sec
DL_GF_Imp DL_GF_Imp_dreadstalker melee 0 456995 4244 173.97 1244 2488 312.2 312.2 17.7% 0.0% 0.0% 0.0% 1.89sec 653329 107.69sec
DL_GF_Imp DL_GF_Imp_eye_of_guldan eye_of_guldan ticks -272131 23860 80 11.93 400 0 27.2 59.6 0.0% 0.0% 0.0% 0.0% 4.08sec 23860 13.32sec
DL_GF_Imp DL_GF_Imp_wild_imp fel_firebolt 104318 742765 8692 695.71 637 1274 995.0 990.9 17.7% 0.0% 0.0% 0.0% 0.29sec 742765 85.46sec
DL_GF_Imp DL_GF_Imp_demonic_tyrant demonfire 270481 246635 4644 42.57 5561 11116 37.8 37.7 17.7% 0.0% 0.0% 0.0% 6.89sec 246635 53.11sec
DL_GF_Imp DL_GF_Imp_urzul many_faced_bite 272439 19934 2631 74.80 1792 3584 9.4 9.4 17.7% 0.0% 0.0% 0.0% 12.21sec 28498 7.58sec
DL_GF_Imp DL_GF_Imp_urzul melee 0 33273 4391 336.65 665 1329 42.5 42.5 17.7% 0.0% 0.0% 0.0% 2.61sec 47567 7.58sec
DL_GF_Imp DL_GF_Imp_vicious_hellhound demon_fangs 272013 26110 1791 38.13 2393 4793 9.3 9.3 17.7% 0.0% 0.0% 0.0% 12.41sec 26110 14.58sec
DL_GF_Imp DL_GF_Imp_vicious_hellhound melee 0 16184 1110 339.63 167 333 82.5 82.5 17.7% 0.0% 0.0% 0.0% 1.34sec 23137 14.58sec
DL_GF_Imp DL_GF_Imp_bilescourge toxic_bile 272167 154519 15528 329.67 2401 4802 54.7 54.7 17.7% 0.0% 0.0% 0.0% 2.05sec 154519 9.95sec
DL_GF_Imp DL_GF_Imp_illidari_satyr melee 0 16512 1707 261.76 332 665 42.2 42.2 17.7% 0.0% 0.0% 0.0% 2.73sec 23606 9.67sec
DL_GF_Imp DL_GF_Imp_illidari_satyr melee_oh 0 8254 853 261.76 166 332 42.2 42.2 17.7% 0.0% 0.0% 0.0% 2.73sec 11800 9.67sec
DL_GF_Imp DL_GF_Imp_illidari_satyr shadow_slash 272012 25416 2628 55.87 2395 4794 9.0 9.0 17.8% 0.0% 0.0% 0.0% 13.20sec 25416 9.67sec
DL_GF_Imp DL_GF_Imp_wrathguard melee 0 33299 3668 281.00 665 1330 42.5 42.5 17.8% 0.0% 0.0% 0.0% 2.68sec 47604 9.08sec
DL_GF_Imp DL_GF_Imp_wrathguard melee_oh 0 16621 1831 281.00 332 665 42.5 42.5 17.6% 0.0% 0.0% 0.0% 2.68sec 23761 9.08sec
DL_GF_Imp DL_GF_Imp_wrathguard overhead_assault 272432 18728 2063 58.67 1795 3592 8.9 8.9 17.5% 0.0% 0.0% 0.0% 13.30sec 26774 9.08sec
DL_GF_Imp DL_GF_Imp_void_terror double_breath 272156 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 11.62sec
DL_GF_Imp DL_GF_Imp_void_terror double_breath1 272156 19899 1712 36.70 2388 4775 7.1 7.1 17.2% 0.0% 0.0% 0.0% 17.07sec 19899 11.62sec
DL_GF_Imp DL_GF_Imp_void_terror double_breath2 272156 19988 1720 36.70 2389 4774 7.1 7.1 17.8% 0.0% 0.0% 0.0% 17.07sec 19988 11.62sec
DL_GF_Imp DL_GF_Imp_void_terror melee 0 33667 2897 222.30 665 1329 43.1 43.1 17.6% 0.0% 0.0% 0.0% 2.65sec 48130 11.62sec
DL_GF_Imp DL_GF_Imp_prince_malchezaar melee 0 77698 3918 63.39 3145 6300 20.9 20.9 17.9% 0.0% 0.0% 0.0% 1.32sec 111078 19.83sec
DL_GF_Imp DL_GF_Imp_prince_malchezaar melee_oh 0 38518 1942 63.39 1574 3139 20.9 20.9 16.9% 0.0% 0.0% 0.0% 1.32sec 55066 19.83sec
DL_ID_Felguard DL_ID_Felguard augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_ID_Felguard DL_ID_Felguard berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.90sec 0 299.99sec
DL_ID_Felguard DL_ID_Felguard call_dreadstalkers 104316 0 0 0.00 0 0 14.6 0.0 0.0% 0.0% 0.0% 0.0% 21.04sec 0 299.99sec
DL_ID_Felguard DL_ID_Felguard demonbolt 264178 399994 1333 9.56 7114 14229 47.0 47.8 17.6% 0.0% 0.0% 0.0% 5.82sec 399994 299.99sec
DL_ID_Felguard DL_ID_Felguard flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_ID_Felguard DL_ID_Felguard food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_ID_Felguard DL_ID_Felguard hand_of_guldan 105174 329631 1099 12.55 4465 8910 62.9 62.7 17.7% 0.0% 0.0% 0.0% 4.72sec 329631 299.99sec
DL_ID_Felguard DL_ID_Felguard heed_my_call 271685 42269 141 1.46 4925 9849 7.3 7.3 17.7% 0.0% 0.0% 0.0% 36.60sec 42269 299.99sec
DL_ID_Felguard DL_ID_Felguard heed_my_call_aoe 271686 18078 60 1.46 2111 4221 7.3 7.3 17.4% 0.0% 0.0% 0.0% 36.60sec 18078 299.99sec
DL_ID_Felguard DL_ID_Felguard inner_demons 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_ID_Felguard DL_ID_Felguard nether_portal 267217 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_ID_Felguard DL_ID_Felguard potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_ID_Felguard DL_ID_Felguard shadow_bolt 686 394979 1317 18.69 3593 7185 94.1 93.4 17.7% 0.0% 0.0% 0.0% 3.13sec 394979 299.99sec
DL_ID_Felguard DL_ID_Felguard summon_demonic_tyrant 265187 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.53sec 0 299.99sec
DL_ID_Felguard DL_ID_Felguard summon_felguard 30146 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_ID_Felguard DL_ID_Felguard summon_random_demon 0 0 0 0.00 0 0 17.8 0.0 0.0% 0.0% 0.0% 0.0% 14.57sec 0 299.99sec
DL_ID_Felguard DL_ID_Felguard summon_vilefiend 264119 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 47.17sec 0 299.99sec
DL_ID_Felguard DL_ID_Felguard volatile_blood_explosion 278057 86285 288 1.43 10240 20481 7.3 7.2 17.8% 0.0% 0.0% 0.0% 36.98sec 86285 299.99sec
DL_ID_Felguard DL_ID_Felguard_felguard felstorm ticks -89751 113740 379 12.42 1556 3111 10.4 62.1 17.7% 0.0% 0.0% 0.0% 30.14sec 162605 299.99sec
DL_ID_Felguard DL_ID_Felguard_felguard legion_strike 30213 317856 1060 11.69 4626 9252 58.4 58.4 17.6% 0.0% 0.0% 0.0% 5.09sec 454414 299.99sec
DL_ID_Felguard DL_ID_Felguard_felguard melee 0 358796 1196 34.74 1755 3510 173.7 173.7 17.7% 0.0% 0.0% 0.0% 1.71sec 512942 299.99sec
DL_ID_Felguard DL_ID_Felguard_vicious_hellhound demon_fangs 272013 29258 1697 36.46 2374 4748 10.5 10.5 17.6% 0.0% 0.0% 0.0% 12.80sec 29258 17.24sec
DL_ID_Felguard DL_ID_Felguard_vicious_hellhound melee 0 17900 1038 319.97 165 331 92.0 92.0 17.8% 0.0% 0.0% 0.0% 1.41sec 25591 17.24sec
DL_ID_Felguard DL_ID_Felguard_illidari_satyr melee 0 18440 1521 235.34 330 659 47.5 47.5 17.6% 0.0% 0.0% 0.0% 2.81sec 26363 12.12sec
DL_ID_Felguard DL_ID_Felguard_illidari_satyr melee_oh 0 9225 761 235.34 165 330 47.5 47.5 17.7% 0.0% 0.0% 0.0% 2.81sec 13188 12.12sec
DL_ID_Felguard DL_ID_Felguard_illidari_satyr shadow_slash 272012 28748 2372 50.92 2376 4754 10.3 10.3 17.6% 0.0% 0.0% 0.0% 13.31sec 28748 12.12sec
DL_ID_Felguard DL_ID_Felguard_vilefiend bile_spit 267997 70745 472 2.73 8823 17638 6.8 6.8 17.4% 0.0% 0.0% 0.0% 47.17sec 163643 150.02sec
DL_ID_Felguard DL_ID_Felguard_vilefiend bile_spit ticks -267997 92898 310 6.69 2777 0 6.8 33.5 0.0% 0.0% 0.0% 0.0% 47.17sec 163643 150.02sec
DL_ID_Felguard DL_ID_Felguard_vilefiend headbutt 267999 109915 733 12.05 3100 6200 30.1 30.1 17.7% 0.0% 0.0% 0.0% 9.80sec 157137 150.02sec
DL_ID_Felguard DL_ID_Felguard_vilefiend melee 0 193968 1293 43.20 1526 3051 108.0 108.0 17.7% 0.0% 0.0% 0.0% 2.71sec 277301 150.02sec
DL_ID_Felguard DL_ID_Felguard_bilescourge toxic_bile 272167 169917 17828 381.37 2383 4766 60.6 60.6 17.7% 0.0% 0.0% 0.0% 2.07sec 169917 9.53sec
DL_ID_Felguard DL_ID_Felguard_dreadstalker dreadbite 205196 263661 2444 16.15 7719 15435 29.0 29.0 17.6% 0.0% 0.0% 0.0% 21.04sec 263661 107.90sec
DL_ID_Felguard DL_ID_Felguard_dreadstalker melee 0 455881 4225 173.43 1243 2485 311.9 311.9 17.6% 0.0% 0.0% 0.0% 1.90sec 651737 107.90sec
DL_ID_Felguard DL_ID_Felguard_wild_imp fel_firebolt 104318 912149 12324 982.36 640 1279 1216.7 1211.8 17.7% 0.0% 0.0% 0.0% 0.24sec 912149 74.01sec
DL_ID_Felguard DL_ID_Felguard_darkhound fel_bite 272435 20917 1480 42.52 1779 3557 10.0 10.0 17.4% 0.0% 0.0% 0.0% 12.93sec 29903 14.13sec
DL_ID_Felguard DL_ID_Felguard_darkhound melee 0 36692 2597 200.78 659 1318 47.3 47.3 17.7% 0.0% 0.0% 0.0% 2.67sec 52455 14.13sec
DL_ID_Felguard DL_ID_Felguard_demonic_tyrant demonfire 270481 246222 4659 42.68 5561 11128 37.7 37.6 17.8% 0.0% 0.0% 0.0% 6.87sec 246222 52.85sec
DL_ID_Felguard DL_ID_Felguard_void_terror double_breath 272156 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 13.97sec
DL_ID_Felguard DL_ID_Felguard_void_terror double_breath1 272156 22172 1587 34.14 2367 4739 8.0 8.0 17.8% 0.0% 0.0% 0.0% 17.10sec 22172 13.97sec
DL_ID_Felguard DL_ID_Felguard_void_terror double_breath2 272156 22153 1585 34.14 2368 4732 8.0 8.0 17.7% 0.0% 0.0% 0.0% 17.10sec 22153 13.97sec
DL_ID_Felguard DL_ID_Felguard_void_terror melee 0 37039 2651 204.86 660 1319 47.7 47.7 17.7% 0.0% 0.0% 0.0% 2.69sec 52951 13.97sec
DL_ID_Felguard DL_ID_Felguard_urzul many_faced_bite 272439 22007 2084 59.86 1777 3556 10.5 10.5 17.5% 0.0% 0.0% 0.0% 12.07sec 31461 10.56sec
DL_ID_Felguard DL_ID_Felguard_urzul melee 0 36369 3443 266.40 660 1319 46.9 46.9 17.6% 0.0% 0.0% 0.0% 2.63sec 51994 10.56sec
DL_ID_Felguard DL_ID_Felguard_shivarra melee 0 36252 3384 261.96 659 1319 46.8 46.8 17.6% 0.0% 0.0% 0.0% 2.76sec 51827 10.71sec
DL_ID_Felguard DL_ID_Felguard_shivarra melee_oh 0 18128 1692 261.96 330 659 46.8 46.8 17.6% 0.0% 0.0% 0.0% 2.76sec 25916 10.71sec
DL_ID_Felguard DL_ID_Felguard_shivarra multislash 272172 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 10.71sec
DL_ID_Felguard DL_ID_Felguard_shivarra multislash1 272172 7514 701 42.87 835 1668 7.7 7.7 17.7% 0.0% 0.0% 0.0% 18.08sec 10742 10.71sec
DL_ID_Felguard DL_ID_Felguard_shivarra multislash2 272172 7506 701 42.87 835 1668 7.7 7.7 17.5% 0.0% 0.0% 0.0% 18.08sec 10730 10.71sec
DL_ID_Felguard DL_ID_Felguard_shivarra multislash3 272172 7491 699 42.87 835 1670 7.7 7.7 17.3% 0.0% 0.0% 0.0% 18.08sec 10709 10.71sec
DL_ID_Felguard DL_ID_Felguard_shivarra multislash4 272172 7519 702 42.87 835 1669 7.7 7.7 17.7% 0.0% 0.0% 0.0% 18.08sec 10749 10.71sec
DL_ID_Felguard DL_ID_Felguard_wrathguard melee 0 36525 3162 244.37 660 1319 47.1 47.1 17.7% 0.0% 0.0% 0.0% 2.71sec 52217 11.55sec
DL_ID_Felguard DL_ID_Felguard_wrathguard melee_oh 0 18272 1582 244.37 330 660 47.1 47.1 17.7% 0.0% 0.0% 0.0% 2.71sec 26121 11.55sec
DL_ID_Felguard DL_ID_Felguard_wrathguard overhead_assault 272432 20793 1800 51.56 1780 3554 9.9 9.9 17.7% 0.0% 0.0% 0.0% 13.23sec 29727 11.55sec
DL_ID_Felguard DL_ID_Felguard_prince_malchezaar melee 0 77056 6104 99.54 3123 6243 20.9 20.9 17.8% 0.0% 0.0% 0.0% 1.45sec 110161 12.62sec
DL_ID_Felguard DL_ID_Felguard_prince_malchezaar melee_oh 0 38514 3051 99.54 1561 3127 20.9 20.9 17.7% 0.0% 0.0% 0.0% 1.45sec 55060 12.62sec
DL_ID_Felguard DL_ID_Felguard_eye_of_guldan eye_of_guldan ticks -272131 24330 81 12.19 399 0 28.3 61.0 0.0% 0.0% 0.0% 0.0% 5.01sec 24330 16.63sec
DL_ID_Imp DL_ID_Imp augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_ID_Imp DL_ID_Imp berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.80sec 0 299.99sec
DL_ID_Imp DL_ID_Imp call_dreadstalkers 104316 0 0 0.00 0 0 14.6 0.0 0.0% 0.0% 0.0% 0.0% 21.04sec 0 299.99sec
DL_ID_Imp DL_ID_Imp demonbolt 264178 400634 1336 9.56 7115 14230 47.0 47.8 17.8% 0.0% 0.0% 0.0% 5.80sec 400634 299.99sec
DL_ID_Imp DL_ID_Imp flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_ID_Imp DL_ID_Imp food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_ID_Imp DL_ID_Imp hand_of_guldan 105174 329686 1099 12.55 4463 8925 62.9 62.7 17.8% 0.0% 0.0% 0.0% 4.72sec 329686 299.99sec
DL_ID_Imp DL_ID_Imp heed_my_call 271685 42140 140 1.45 4925 9849 7.3 7.3 17.7% 0.0% 0.0% 0.0% 37.16sec 42140 299.99sec
DL_ID_Imp DL_ID_Imp heed_my_call_aoe 271686 18068 60 1.45 2111 4221 7.3 7.3 17.7% 0.0% 0.0% 0.0% 37.16sec 18068 299.99sec
DL_ID_Imp DL_ID_Imp inner_demons 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_ID_Imp DL_ID_Imp nether_portal 267217 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_ID_Imp DL_ID_Imp potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_ID_Imp DL_ID_Imp shadow_bolt 686 394522 1315 18.67 3593 7187 94.0 93.4 17.6% 0.0% 0.0% 0.0% 3.13sec 394522 299.99sec
DL_ID_Imp DL_ID_Imp summon_demonic_tyrant 265187 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.47sec 0 299.99sec
DL_ID_Imp DL_ID_Imp summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_ID_Imp DL_ID_Imp summon_random_demon 0 0 0 0.00 0 0 17.8 0.0 0.0% 0.0% 0.0% 0.0% 14.71sec 0 299.99sec
DL_ID_Imp DL_ID_Imp summon_vilefiend 264119 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 47.18sec 0 299.99sec
DL_ID_Imp DL_ID_Imp volatile_blood_explosion 278057 86731 289 1.44 10240 20481 7.3 7.2 17.6% 0.0% 0.0% 0.0% 36.84sec 86731 299.99sec
DL_ID_Imp DL_ID_Imp_imp firebolt 3110 939897 3133 20.60 7759 15519 103.8 103.0 17.6% 0.0% 0.0% 0.0% 2.89sec 939897 299.99sec
DL_ID_Imp DL_ID_Imp_illidari_satyr melee 0 18220 1819 281.38 330 660 47.0 47.0 17.6% 0.0% 0.0% 0.0% 2.77sec 26048 10.02sec
DL_ID_Imp DL_ID_Imp_illidari_satyr melee_oh 0 9117 910 281.38 165 330 47.0 47.0 17.7% 0.0% 0.0% 0.0% 2.77sec 13034 10.02sec
DL_ID_Imp DL_ID_Imp_illidari_satyr shadow_slash 272012 28453 2841 61.04 2376 4750 10.2 10.2 17.6% 0.0% 0.0% 0.0% 13.09sec 28453 10.02sec
DL_ID_Imp DL_ID_Imp_void_terror double_breath 272156 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 9.85sec
DL_ID_Imp DL_ID_Imp_void_terror double_breath1 272156 21877 2221 47.81 2368 4728 7.8 7.8 17.8% 0.0% 0.0% 0.0% 17.47sec 21877 9.85sec
DL_ID_Imp DL_ID_Imp_void_terror double_breath2 272156 21885 2222 47.81 2367 4737 7.8 7.8 17.8% 0.0% 0.0% 0.0% 17.47sec 21885 9.85sec
DL_ID_Imp DL_ID_Imp_void_terror melee 0 36487 3705 286.57 660 1319 47.0 47.0 17.6% 0.0% 0.0% 0.0% 2.74sec 52163 9.85sec
DL_ID_Imp DL_ID_Imp_vilefiend bile_spit 267997 70747 472 2.73 8822 17650 6.8 6.8 17.4% 0.0% 0.0% 0.0% 47.18sec 163657 149.93sec
DL_ID_Imp DL_ID_Imp_vilefiend bile_spit ticks -267997 92911 310 6.69 2778 0 6.8 33.4 0.0% 0.0% 0.0% 0.0% 47.18sec 163657 149.93sec
DL_ID_Imp DL_ID_Imp_vilefiend headbutt 267999 109907 733 12.05 3100 6201 30.1 30.1 17.7% 0.0% 0.0% 0.0% 9.83sec 157126 149.93sec
DL_ID_Imp DL_ID_Imp_vilefiend melee 0 193589 1291 43.17 1526 3051 107.9 107.9 17.6% 0.0% 0.0% 0.0% 2.71sec 276759 149.93sec
DL_ID_Imp DL_ID_Imp_darkhound fel_bite 272435 21038 2037 58.42 1780 3562 10.1 10.1 17.5% 0.0% 0.0% 0.0% 13.22sec 30076 10.33sec
DL_ID_Imp DL_ID_Imp_darkhound melee 0 36938 3576 276.45 660 1321 47.6 47.6 17.6% 0.0% 0.0% 0.0% 2.72sec 52807 10.33sec
DL_ID_Imp DL_ID_Imp_dreadstalker dreadbite 205196 263890 2436 16.08 7720 15438 29.0 29.0 17.7% 0.0% 0.0% 0.0% 21.04sec 263890 108.33sec
DL_ID_Imp DL_ID_Imp_dreadstalker melee 0 455787 4207 172.61 1243 2485 311.7 311.7 17.7% 0.0% 0.0% 0.0% 1.90sec 651603 108.33sec
DL_ID_Imp DL_ID_Imp_wrathguard melee 0 36873 2522 194.91 659 1319 47.5 47.5 17.7% 0.0% 0.0% 0.0% 2.73sec 52715 14.62sec
DL_ID_Imp DL_ID_Imp_wrathguard melee_oh 0 18430 1261 194.91 330 659 47.5 47.5 17.7% 0.0% 0.0% 0.0% 2.73sec 26348 14.62sec
DL_ID_Imp DL_ID_Imp_wrathguard overhead_assault 272432 21019 1438 41.24 1779 3550 10.0 10.0 17.6% 0.0% 0.0% 0.0% 13.27sec 30049 14.62sec
DL_ID_Imp DL_ID_Imp_wild_imp fel_firebolt 104318 912393 10004 797.37 640 1279 1216.9 1212.0 17.7% 0.0% 0.0% 0.0% 0.24sec 912393 91.20sec
DL_ID_Imp DL_ID_Imp_demonic_tyrant demonfire 270481 246165 4656 42.64 5561 11126 37.6 37.6 17.8% 0.0% 0.0% 0.0% 6.86sec 246165 52.87sec
DL_ID_Imp DL_ID_Imp_urzul many_faced_bite 272439 22547 1739 50.02 1777 3551 10.8 10.8 17.4% 0.0% 0.0% 0.0% 12.40sec 32234 12.97sec
DL_ID_Imp DL_ID_Imp_urzul melee 0 37382 2883 222.63 659 1319 48.1 48.1 17.8% 0.0% 0.0% 0.0% 2.72sec 53442 12.97sec
DL_ID_Imp DL_ID_Imp_bilescourge toxic_bile 272167 169808 11837 253.21 2384 4766 60.6 60.5 17.7% 0.0% 0.0% 0.0% 2.14sec 169808 14.35sec
DL_ID_Imp DL_ID_Imp_shivarra melee 0 36500 2280 176.24 659 1318 47.0 47.0 17.7% 0.0% 0.0% 0.0% 2.80sec 52181 16.01sec
DL_ID_Imp DL_ID_Imp_shivarra melee_oh 0 18238 1139 176.24 330 659 47.0 47.0 17.7% 0.0% 0.0% 0.0% 2.80sec 26074 16.01sec
DL_ID_Imp DL_ID_Imp_shivarra multislash 272172 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 16.01sec
DL_ID_Imp DL_ID_Imp_shivarra multislash1 272172 7565 473 28.82 835 1673 7.7 7.7 17.8% 0.0% 0.0% 0.0% 18.31sec 10815 16.01sec
DL_ID_Imp DL_ID_Imp_shivarra multislash2 272172 7551 472 28.82 836 1668 7.7 7.7 17.6% 0.0% 0.0% 0.0% 18.31sec 10795 16.01sec
DL_ID_Imp DL_ID_Imp_shivarra multislash3 272172 7546 471 28.82 835 1670 7.7 7.7 17.5% 0.0% 0.0% 0.0% 18.31sec 10787 16.01sec
DL_ID_Imp DL_ID_Imp_shivarra multislash4 272172 7566 473 28.82 835 1672 7.7 7.7 17.8% 0.0% 0.0% 0.0% 18.31sec 10816 16.01sec
DL_ID_Imp DL_ID_Imp_vicious_hellhound demon_fangs 272013 29303 2325 49.76 2374 4745 10.5 10.5 18.1% 0.0% 0.0% 0.0% 12.85sec 29303 12.60sec
DL_ID_Imp DL_ID_Imp_vicious_hellhound melee 0 17796 1412 435.50 165 331 91.5 91.5 17.7% 0.0% 0.0% 0.0% 1.43sec 25441 12.60sec
DL_ID_Imp DL_ID_Imp_prince_malchezaar melee 0 76679 4248 69.09 3127 6263 20.8 20.8 17.9% 0.0% 0.0% 0.0% 1.59sec 109622 18.05sec
DL_ID_Imp DL_ID_Imp_prince_malchezaar melee_oh 0 38198 2116 69.09 1563 3131 20.8 20.8 17.5% 0.0% 0.0% 0.0% 1.59sec 54609 18.05sec
DL_ID_Imp DL_ID_Imp_eye_of_guldan eye_of_guldan ticks -272131 24353 81 12.19 399 0 28.2 61.0 0.0% 0.0% 0.0% 0.0% 5.45sec 24353 10.41sec
DStr_GF_Felguard DStr_GF_Felguard augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_GF_Felguard DStr_GF_Felguard berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.80sec 0 299.99sec
DStr_GF_Felguard DStr_GF_Felguard call_dreadstalkers 104316 0 0 0.00 0 0 14.5 0.0 0.0% 0.0% 0.0% 0.0% 20.95sec 0 299.99sec
DStr_GF_Felguard DStr_GF_Felguard demonbolt 264178 369468 1232 8.85 7099 14199 43.4 44.3 17.6% 0.0% 0.0% 0.0% 6.31sec 369468 299.99sec
DStr_GF_Felguard DStr_GF_Felguard demonic_strength 267171 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 60.48sec 0 299.99sec
DStr_GF_Felguard DStr_GF_Felguard flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_GF_Felguard DStr_GF_Felguard food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_GF_Felguard DStr_GF_Felguard grimoire_felguard 111898 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.76sec 0 299.99sec
DStr_GF_Felguard DStr_GF_Felguard hand_of_guldan 105174 306989 1023 11.82 4416 8850 59.2 59.1 17.5% 0.0% 0.0% 0.0% 4.98sec 306989 299.99sec
DStr_GF_Felguard DStr_GF_Felguard heed_my_call 271685 42316 141 1.46 4925 9849 7.3 7.3 17.7% 0.0% 0.0% 0.0% 37.03sec 42316 299.99sec
DStr_GF_Felguard DStr_GF_Felguard heed_my_call_aoe 271686 18166 61 1.46 2111 4221 7.3 7.3 17.9% 0.0% 0.0% 0.0% 37.03sec 18166 299.99sec
DStr_GF_Felguard DStr_GF_Felguard nether_portal 267217 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.56sec 0 299.99sec
DStr_GF_Felguard DStr_GF_Felguard potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_GF_Felguard DStr_GF_Felguard shadow_bolt 686 390858 1303 18.48 3592 7185 93.0 92.4 17.8% 0.0% 0.0% 0.0% 3.13sec 390858 299.99sec
DStr_GF_Felguard DStr_GF_Felguard summon_demonic_tyrant 265187 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.73sec 0 299.99sec
DStr_GF_Felguard DStr_GF_Felguard summon_felguard 30146 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_GF_Felguard DStr_GF_Felguard summon_random_demon 0 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 13.88sec 0 299.99sec
DStr_GF_Felguard DStr_GF_Felguard summon_vilefiend 264119 0 0 0.00 0 0 6.7 0.0 0.0% 0.0% 0.0% 0.0% 47.39sec 0 299.99sec
DStr_GF_Felguard DStr_GF_Felguard volatile_blood_explosion 278057 86731 289 1.44 10240 20481 7.3 7.2 17.6% 0.0% 0.0% 0.0% 36.98sec 86731 299.99sec
DStr_GF_Felguard DStr_GF_Felguard_felguard demonic_strength_felstorm ticks -89751 237561 792 6.47 6242 12480 5.4 32.4 17.6% 0.0% 0.0% 0.0% 60.73sec 339622 299.99sec
DStr_GF_Felguard DStr_GF_Felguard_felguard felstorm ticks -89751 110072 367 12.12 1546 3094 10.2 60.6 17.4% 0.0% 0.0% 0.0% 30.59sec 157361 299.99sec
DStr_GF_Felguard DStr_GF_Felguard_felguard legion_strike 30213 291148 971 10.64 4647 9300 53.2 53.2 17.7% 0.0% 0.0% 0.0% 5.53sec 416232 299.99sec
DStr_GF_Felguard DStr_GF_Felguard_felguard melee 0 333825 1113 32.22 1760 3519 161.1 161.1 17.8% 0.0% 0.0% 0.0% 1.82sec 477243 299.99sec
DStr_GF_Felguard DStr_GF_Felguard_grimoire_felguard axe_toss 89766 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 80.02sec 0 64.26sec
DStr_GF_Felguard DStr_GF_Felguard_grimoire_felguard felstorm ticks -89751 45480 152 3.89 1992 3984 3.9 19.4 17.5% 0.0% 0.0% 0.0% 80.69sec 65019 64.26sec
DStr_GF_Felguard DStr_GF_Felguard_grimoire_felguard legion_strike 30213 128759 2004 17.19 5947 11896 18.4 18.4 17.6% 0.0% 0.0% 0.0% 13.86sec 184076 64.26sec
DStr_GF_Felguard DStr_GF_Felguard_grimoire_felguard melee 0 109658 1706 38.21 2278 4556 40.9 40.9 17.6% 0.0% 0.0% 0.0% 6.34sec 156769 64.26sec
DStr_GF_Felguard DStr_GF_Felguard_urzul many_faced_bite 272439 19743 1465 41.69 1792 3583 9.4 9.4 17.6% 0.0% 0.0% 0.0% 12.29sec 28224 13.48sec
DStr_GF_Felguard DStr_GF_Felguard_urzul melee 0 33182 2462 188.91 664 1328 42.4 42.4 17.7% 0.0% 0.0% 0.0% 2.63sec 47438 13.48sec
DStr_GF_Felguard DStr_GF_Felguard_vicious_hellhound demon_fangs 272013 25953 2307 49.15 2392 4778 9.2 9.2 17.8% 0.0% 0.0% 0.0% 12.73sec 25953 11.25sec
DStr_GF_Felguard DStr_GF_Felguard_vicious_hellhound melee 0 16043 1426 437.36 166 332 82.0 82.0 17.7% 0.0% 0.0% 0.0% 1.37sec 22935 11.25sec
DStr_GF_Felguard DStr_GF_Felguard_vilefiend bile_spit 267997 70560 493 2.82 8903 17819 6.7 6.7 17.8% 0.0% 0.0% 0.0% 47.39sec 163416 142.98sec
DStr_GF_Felguard DStr_GF_Felguard_vilefiend bile_spit ticks -267997 92856 310 6.59 2819 0 6.7 32.9 0.0% 0.0% 0.0% 0.0% 47.39sec 163416 142.98sec
DStr_GF_Felguard DStr_GF_Felguard_vilefiend headbutt 267999 104760 733 12.05 3107 6215 28.7 28.7 17.4% 0.0% 0.0% 0.0% 10.14sec 149768 142.98sec
DStr_GF_Felguard DStr_GF_Felguard_vilefiend melee 0 186122 1302 43.39 1529 3058 103.4 103.4 17.7% 0.0% 0.0% 0.0% 2.79sec 266084 142.98sec
DStr_GF_Felguard DStr_GF_Felguard_shivarra melee 0 33546 2610 200.36 664 1328 42.9 42.9 17.7% 0.0% 0.0% 0.0% 2.67sec 47959 12.85sec
DStr_GF_Felguard DStr_GF_Felguard_shivarra melee_oh 0 16769 1305 200.36 332 664 42.9 42.9 17.7% 0.0% 0.0% 0.0% 2.67sec 23974 12.85sec
DStr_GF_Felguard DStr_GF_Felguard_shivarra multislash 272172 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 12.85sec
DStr_GF_Felguard DStr_GF_Felguard_shivarra multislash1 272172 6860 534 32.23 843 1686 6.9 6.9 17.8% 0.0% 0.0% 0.0% 17.88sec 9808 12.85sec
DStr_GF_Felguard DStr_GF_Felguard_shivarra multislash2 272172 6873 535 32.23 844 1684 6.9 6.9 18.1% 0.0% 0.0% 0.0% 17.88sec 9826 12.85sec
DStr_GF_Felguard DStr_GF_Felguard_shivarra multislash3 272172 6840 532 32.23 843 1686 6.9 6.9 17.5% 0.0% 0.0% 0.0% 17.88sec 9778 12.85sec
DStr_GF_Felguard DStr_GF_Felguard_shivarra multislash4 272172 6847 533 32.23 843 1687 6.9 6.9 17.6% 0.0% 0.0% 0.0% 17.88sec 9788 12.85sec
DStr_GF_Felguard DStr_GF_Felguard_dreadstalker dreadbite 205196 210450 1942 16.05 6174 12336 29.0 29.0 17.6% 0.0% 0.0% 0.0% 20.95sec 210450 108.38sec
DStr_GF_Felguard DStr_GF_Felguard_dreadstalker melee 0 457095 4218 172.93 1244 2487 312.4 312.4 17.7% 0.0% 0.0% 0.0% 1.88sec 653472 108.38sec
DStr_GF_Felguard DStr_GF_Felguard_darkhound fel_bite 272435 18626 1316 37.37 1794 3588 8.8 8.8 17.8% 0.0% 0.0% 0.0% 13.56sec 26628 14.15sec
DStr_GF_Felguard DStr_GF_Felguard_darkhound melee 0 33069 2336 179.48 664 1328 42.3 42.3 17.7% 0.0% 0.0% 0.0% 2.74sec 47276 14.15sec
DStr_GF_Felguard DStr_GF_Felguard_demonic_tyrant demonfire 270481 245616 4642 42.59 5561 11127 37.6 37.6 17.6% 0.0% 0.0% 0.0% 6.92sec 245616 52.91sec
DStr_GF_Felguard DStr_GF_Felguard_wild_imp fel_firebolt 104318 729777 9825 786.11 637 1274 977.2 973.1 17.7% 0.0% 0.0% 0.0% 0.30sec 729777 74.27sec
DStr_GF_Felguard DStr_GF_Felguard_void_terror double_breath 272156 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 12.31sec
DStr_GF_Felguard DStr_GF_Felguard_void_terror double_breath1 272156 19894 1616 34.63 2385 4772 7.1 7.1 17.4% 0.0% 0.0% 0.0% 17.31sec 19894 12.31sec
DStr_GF_Felguard DStr_GF_Felguard_void_terror double_breath2 272156 19944 1620 34.63 2385 4773 7.1 7.1 17.7% 0.0% 0.0% 0.0% 17.31sec 19944 12.31sec
DStr_GF_Felguard DStr_GF_Felguard_void_terror melee 0 33755 2742 210.50 664 1327 43.2 43.2 17.8% 0.0% 0.0% 0.0% 2.67sec 48257 12.31sec
DStr_GF_Felguard DStr_GF_Felguard_illidari_satyr melee 0 16544 1212 186.63 332 663 42.4 42.4 17.5% 0.0% 0.0% 0.0% 2.65sec 23651 13.64sec
DStr_GF_Felguard DStr_GF_Felguard_illidari_satyr melee_oh 0 8294 608 186.63 166 332 42.4 42.4 17.8% 0.0% 0.0% 0.0% 2.65sec 11858 13.64sec
DStr_GF_Felguard DStr_GF_Felguard_illidari_satyr shadow_slash 272012 25463 1866 39.80 2394 4790 9.1 9.1 17.5% 0.0% 0.0% 0.0% 12.70sec 25463 13.64sec
DStr_GF_Felguard DStr_GF_Felguard_bilescourge toxic_bile 272167 153515 13262 282.10 2397 4794 54.4 54.4 17.7% 0.0% 0.0% 0.0% 2.09sec 153515 11.58sec
DStr_GF_Felguard DStr_GF_Felguard_wrathguard melee 0 33259 3224 247.50 664 1328 42.6 42.6 17.7% 0.0% 0.0% 0.0% 2.62sec 47548 10.32sec
DStr_GF_Felguard DStr_GF_Felguard_wrathguard melee_oh 0 16645 1613 247.50 332 664 42.6 42.6 17.8% 0.0% 0.0% 0.0% 2.62sec 23796 10.32sec
DStr_GF_Felguard DStr_GF_Felguard_wrathguard overhead_assault 272432 18661 1809 51.46 1795 3585 8.8 8.8 17.5% 0.0% 0.0% 0.0% 13.12sec 26678 10.32sec
DStr_GF_Felguard DStr_GF_Felguard_prince_malchezaar melee 0 79672 5164 83.75 3145 6294 21.5 21.5 17.6% 0.0% 0.0% 0.0% 1.58sec 113901 15.43sec
DStr_GF_Felguard DStr_GF_Felguard_prince_malchezaar melee_oh 0 39789 2579 83.75 1573 3145 21.5 21.5 17.5% 0.0% 0.0% 0.0% 1.58sec 56883 15.43sec
DStr_GF_Felguard DStr_GF_Felguard_eye_of_guldan eye_of_guldan ticks -272131 24099 80 12.03 401 0 27.9 60.2 0.0% 0.0% 0.0% 0.0% 4.42sec 24099 16.94sec
DStr_GF_Imp DStr_GF_Imp augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_GF_Imp DStr_GF_Imp berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.31sec 0 299.99sec
DStr_GF_Imp DStr_GF_Imp call_dreadstalkers 104316 0 0 0.00 0 0 14.6 0.0 0.0% 0.0% 0.0% 0.0% 20.94sec 0 299.99sec
DStr_GF_Imp DStr_GF_Imp demonbolt 264178 375901 1253 8.99 7110 14224 44.1 44.9 17.7% 0.0% 0.0% 0.0% 6.21sec 375901 299.99sec
DStr_GF_Imp DStr_GF_Imp flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_GF_Imp DStr_GF_Imp food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_GF_Imp DStr_GF_Imp grimoire_felguard 111898 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.74sec 0 299.99sec
DStr_GF_Imp DStr_GF_Imp hand_of_guldan 105174 315524 1052 12.05 4448 8903 60.4 60.3 17.7% 0.0% 0.0% 0.0% 4.90sec 315524 299.99sec
DStr_GF_Imp DStr_GF_Imp heed_my_call 271685 41738 139 1.44 4925 9849 7.2 7.2 17.4% 0.0% 0.0% 0.0% 36.91sec 41738 299.99sec
DStr_GF_Imp DStr_GF_Imp heed_my_call_aoe 271686 17900 60 1.44 2111 4221 7.2 7.2 17.5% 0.0% 0.0% 0.0% 36.91sec 17900 299.99sec
DStr_GF_Imp DStr_GF_Imp nether_portal 267217 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_GF_Imp DStr_GF_Imp potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_GF_Imp DStr_GF_Imp shadow_bolt 686 402370 1341 19.02 3594 7190 95.8 95.1 17.7% 0.0% 0.0% 0.0% 3.06sec 402370 299.99sec
DStr_GF_Imp DStr_GF_Imp summon_demonic_tyrant 265187 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.51sec 0 299.99sec
DStr_GF_Imp DStr_GF_Imp summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_GF_Imp DStr_GF_Imp summon_random_demon 0 0 0 0.00 0 0 15.1 0.0 0.0% 0.0% 0.0% 0.0% 14.66sec 0 299.99sec
DStr_GF_Imp DStr_GF_Imp summon_vilefiend 264119 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 47.22sec 0 299.99sec
DStr_GF_Imp DStr_GF_Imp volatile_blood_explosion 278057 86934 290 1.44 10240 20481 7.3 7.2 17.6% 0.0% 0.0% 0.0% 36.87sec 86934 299.99sec
DStr_GF_Imp DStr_GF_Imp_imp firebolt 3110 941862 3140 20.60 7776 15544 103.8 103.0 17.6% 0.0% 0.0% 0.0% 2.89sec 941862 299.99sec
DStr_GF_Imp DStr_GF_Imp_grimoire_felguard axe_toss 89766 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 80.15sec 0 64.40sec
DStr_GF_Imp DStr_GF_Imp_grimoire_felguard felstorm ticks -89751 45568 152 3.90 1989 3976 3.9 19.5 17.7% 0.0% 0.0% 0.0% 80.59sec 65145 64.40sec
DStr_GF_Imp DStr_GF_Imp_grimoire_felguard legion_strike 30213 129619 2013 17.19 5953 11913 18.5 18.5 18.0% 0.0% 0.0% 0.0% 13.86sec 185306 64.40sec
DStr_GF_Imp DStr_GF_Imp_grimoire_felguard melee 0 109823 1705 38.15 2280 4561 41.0 41.0 17.6% 0.0% 0.0% 0.0% 6.35sec 157005 64.40sec
DStr_GF_Imp DStr_GF_Imp_shivarra melee 0 33253 2290 175.86 665 1329 42.6 42.6 17.6% 0.0% 0.0% 0.0% 2.64sec 47539 14.52sec
DStr_GF_Imp DStr_GF_Imp_shivarra melee_oh 0 16654 1147 175.86 332 664 42.6 42.6 17.8% 0.0% 0.0% 0.0% 2.64sec 23809 14.52sec
DStr_GF_Imp DStr_GF_Imp_shivarra multislash 272172 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 14.52sec
DStr_GF_Imp DStr_GF_Imp_shivarra multislash1 272172 6827 470 28.45 843 1688 6.9 6.9 17.5% 0.0% 0.0% 0.0% 17.66sec 9760 14.52sec
DStr_GF_Imp DStr_GF_Imp_shivarra multislash2 272172 6849 472 28.45 844 1685 6.9 6.9 17.9% 0.0% 0.0% 0.0% 17.66sec 9791 14.52sec
DStr_GF_Imp DStr_GF_Imp_shivarra multislash3 272172 6823 470 28.45 844 1685 6.9 6.9 17.5% 0.0% 0.0% 0.0% 17.66sec 9754 14.52sec
DStr_GF_Imp DStr_GF_Imp_shivarra multislash4 272172 6816 469 28.45 844 1688 6.9 6.9 17.3% 0.0% 0.0% 0.0% 17.66sec 9744 14.52sec
DStr_GF_Imp DStr_GF_Imp_vicious_hellhound demon_fangs 272013 26200 1980 42.02 2394 4781 9.3 9.3 18.1% 0.0% 0.0% 0.0% 12.46sec 26200 13.23sec
DStr_GF_Imp DStr_GF_Imp_vicious_hellhound melee 0 16122 1218 373.13 167 333 82.3 82.3 17.6% 0.0% 0.0% 0.0% 1.35sec 23048 13.23sec
DStr_GF_Imp DStr_GF_Imp_vilefiend bile_spit 267997 71112 500 2.86 8928 17858 6.8 6.8 17.5% 0.0% 0.0% 0.0% 47.22sec 164776 142.12sec
DStr_GF_Imp DStr_GF_Imp_vilefiend bile_spit ticks -267997 93664 312 6.64 2822 0 6.8 33.2 0.0% 0.0% 0.0% 0.0% 47.22sec 164776 142.12sec
DStr_GF_Imp DStr_GF_Imp_vilefiend headbutt 267999 104149 733 12.05 3106 6209 28.5 28.5 17.5% 0.0% 0.0% 0.0% 10.24sec 148893 142.12sec
DStr_GF_Imp DStr_GF_Imp_vilefiend melee 0 185316 1304 43.43 1531 3060 102.9 102.9 17.7% 0.0% 0.0% 0.0% 2.81sec 264932 142.12sec
DStr_GF_Imp DStr_GF_Imp_bilescourge toxic_bile 272167 155234 13484 286.43 2401 4803 55.0 55.0 17.6% 0.0% 0.0% 0.0% 2.03sec 155234 11.51sec
DStr_GF_Imp DStr_GF_Imp_dreadstalker dreadbite 205196 211519 1949 16.09 6175 12355 29.1 29.1 17.7% 0.0% 0.0% 0.0% 20.94sec 211519 108.51sec
DStr_GF_Imp DStr_GF_Imp_dreadstalker melee 0 457094 4213 172.60 1244 2487 312.1 312.1 17.7% 0.0% 0.0% 0.0% 1.89sec 653471 108.51sec
DStr_GF_Imp DStr_GF_Imp_darkhound fel_bite 272435 18974 1286 36.49 1795 3592 9.0 9.0 17.7% 0.0% 0.0% 0.0% 12.98sec 27126 14.76sec
DStr_GF_Imp DStr_GF_Imp_darkhound melee 0 33564 2274 174.66 665 1329 43.0 43.0 17.5% 0.0% 0.0% 0.0% 2.61sec 47984 14.76sec
DStr_GF_Imp DStr_GF_Imp_wild_imp fel_firebolt 104318 742731 8603 688.59 637 1274 995.0 990.9 17.7% 0.0% 0.0% 0.0% 0.29sec 742731 86.34sec
DStr_GF_Imp DStr_GF_Imp_demonic_tyrant demonfire 270481 246343 4639 42.58 5561 11118 37.8 37.7 17.6% 0.0% 0.0% 0.0% 6.89sec 246343 53.10sec
DStr_GF_Imp DStr_GF_Imp_void_terror double_breath 272156 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 14.70sec
DStr_GF_Imp DStr_GF_Imp_void_terror double_breath1 272156 19924 1355 28.90 2389 4782 7.1 7.1 17.7% 0.0% 0.0% 0.0% 17.75sec 19924 14.70sec
DStr_GF_Imp DStr_GF_Imp_void_terror double_breath2 272156 19981 1359 28.90 2390 4774 7.1 7.1 18.1% 0.0% 0.0% 0.0% 17.75sec 19981 14.70sec
DStr_GF_Imp DStr_GF_Imp_void_terror melee 0 33599 2285 175.24 665 1330 42.9 42.9 17.7% 0.0% 0.0% 0.0% 2.75sec 48034 14.70sec
DStr_GF_Imp DStr_GF_Imp_illidari_satyr melee 0 16668 1791 274.33 332 665 42.6 42.6 17.8% 0.0% 0.0% 0.0% 2.74sec 23829 9.31sec
DStr_GF_Imp DStr_GF_Imp_illidari_satyr melee_oh 0 8319 894 274.33 166 332 42.6 42.6 17.6% 0.0% 0.0% 0.0% 2.74sec 11893 9.31sec
DStr_GF_Imp DStr_GF_Imp_illidari_satyr shadow_slash 272012 25667 2758 58.75 2396 4787 9.1 9.1 17.6% 0.0% 0.0% 0.0% 13.23sec 25667 9.31sec
DStr_GF_Imp DStr_GF_Imp_urzul many_faced_bite 272439 20143 1776 50.52 1793 3589 9.5 9.5 17.7% 0.0% 0.0% 0.0% 12.04sec 28796 11.34sec
DStr_GF_Imp DStr_GF_Imp_urzul melee 0 33714 2973 228.23 665 1330 43.1 43.1 17.6% 0.0% 0.0% 0.0% 2.59sec 48198 11.34sec
DStr_GF_Imp DStr_GF_Imp_wrathguard melee 0 32897 2800 214.74 665 1330 42.0 42.0 17.7% 0.0% 0.0% 0.0% 2.57sec 47030 11.75sec
DStr_GF_Imp DStr_GF_Imp_wrathguard melee_oh 0 16433 1399 214.74 332 665 42.0 42.0 17.6% 0.0% 0.0% 0.0% 2.57sec 23493 11.75sec
DStr_GF_Imp DStr_GF_Imp_wrathguard overhead_assault 272432 18627 1586 44.96 1795 3586 8.8 8.8 17.9% 0.0% 0.0% 0.0% 12.74sec 26630 11.75sec
DStr_GF_Imp DStr_GF_Imp_eye_of_guldan eye_of_guldan ticks -272131 24489 82 12.23 400 0 28.1 61.2 0.0% 0.0% 0.0% 0.0% 4.75sec 24489 12.56sec
DStr_GF_Imp DStr_GF_Imp_prince_malchezaar melee 0 78251 5232 84.42 3152 6304 21.0 21.0 18.0% 0.0% 0.0% 0.0% 1.60sec 111869 14.96sec
DStr_GF_Imp DStr_GF_Imp_prince_malchezaar melee_oh 0 38941 2604 84.42 1576 3151 21.0 21.0 17.4% 0.0% 0.0% 0.0% 1.60sec 55671 14.96sec
DStr_ID_Felguard DStr_ID_Felguard augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_ID_Felguard DStr_ID_Felguard berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.88sec 0 299.99sec
DStr_ID_Felguard DStr_ID_Felguard call_dreadstalkers 104316 0 0 0.00 0 0 14.5 0.0 0.0% 0.0% 0.0% 0.0% 21.06sec 0 299.99sec
DStr_ID_Felguard DStr_ID_Felguard demonbolt 264178 394181 1314 9.42 7110 14217 46.3 47.1 17.7% 0.0% 0.0% 0.0% 5.90sec 394181 299.99sec
DStr_ID_Felguard DStr_ID_Felguard demonic_strength 267171 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 60.47sec 0 299.99sec
DStr_ID_Felguard DStr_ID_Felguard flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_ID_Felguard DStr_ID_Felguard food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_ID_Felguard DStr_ID_Felguard hand_of_guldan 105174 321542 1072 12.31 4436 8893 61.7 61.5 17.7% 0.0% 0.0% 0.0% 4.80sec 321542 299.99sec
DStr_ID_Felguard DStr_ID_Felguard heed_my_call 271685 42328 141 1.46 4925 9849 7.3 7.3 17.6% 0.0% 0.0% 0.0% 36.54sec 42328 299.99sec
DStr_ID_Felguard DStr_ID_Felguard heed_my_call_aoe 271686 18139 60 1.46 2111 4221 7.3 7.3 17.5% 0.0% 0.0% 0.0% 36.54sec 18139 299.99sec
DStr_ID_Felguard DStr_ID_Felguard inner_demons 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_ID_Felguard DStr_ID_Felguard nether_portal 267217 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.53sec 0 299.99sec
DStr_ID_Felguard DStr_ID_Felguard potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_ID_Felguard DStr_ID_Felguard shadow_bolt 686 383140 1277 18.14 3590 7179 91.3 90.7 17.7% 0.0% 0.0% 0.0% 3.21sec 383140 299.99sec
DStr_ID_Felguard DStr_ID_Felguard summon_demonic_tyrant 265187 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.53sec 0 299.99sec
DStr_ID_Felguard DStr_ID_Felguard summon_felguard 30146 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_ID_Felguard DStr_ID_Felguard summon_random_demon 0 0 0 0.00 0 0 17.9 0.0 0.0% 0.0% 0.0% 0.0% 13.89sec 0 299.99sec
DStr_ID_Felguard DStr_ID_Felguard summon_vilefiend 264119 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 47.21sec 0 299.99sec
DStr_ID_Felguard DStr_ID_Felguard volatile_blood_explosion 278057 87219 291 1.45 10240 20481 7.3 7.2 17.7% 0.0% 0.0% 0.0% 36.64sec 87219 299.99sec
DStr_ID_Felguard DStr_ID_Felguard_felguard demonic_strength_felstorm ticks -89751 237945 793 6.47 6262 12512 5.4 32.4 17.5% 0.0% 0.0% 0.0% 60.69sec 340171 299.99sec
DStr_ID_Felguard DStr_ID_Felguard_felguard felstorm ticks -89751 110251 368 12.12 1545 3092 10.2 60.6 17.7% 0.0% 0.0% 0.0% 30.58sec 157617 299.99sec
DStr_ID_Felguard DStr_ID_Felguard_felguard legion_strike 30213 290447 968 10.65 4633 9268 53.2 53.2 17.8% 0.0% 0.0% 0.0% 5.53sec 415229 299.99sec
DStr_ID_Felguard DStr_ID_Felguard_felguard melee 0 333608 1112 32.23 1759 3517 161.2 161.2 17.7% 0.0% 0.0% 0.0% 1.82sec 476933 299.99sec
DStr_ID_Felguard DStr_ID_Felguard_darkhound fel_bite 272435 21027 1686 48.35 1779 3557 10.1 10.1 17.6% 0.0% 0.0% 0.0% 13.64sec 30060 12.47sec
DStr_ID_Felguard DStr_ID_Felguard_darkhound melee 0 37005 2966 229.35 659 1319 47.7 47.7 17.7% 0.0% 0.0% 0.0% 2.79sec 52903 12.47sec
DStr_ID_Felguard DStr_ID_Felguard_vilefiend bile_spit 267997 70722 474 2.73 8827 17662 6.8 6.8 17.8% 0.0% 0.0% 0.0% 47.21sec 163255 149.29sec
DStr_ID_Felguard DStr_ID_Felguard_vilefiend bile_spit ticks -267997 92533 308 6.66 2779 0 6.8 33.3 0.0% 0.0% 0.0% 0.0% 47.21sec 163255 149.29sec
DStr_ID_Felguard DStr_ID_Felguard_vilefiend headbutt 267999 109583 734 12.05 3100 6205 30.0 30.0 17.9% 0.0% 0.0% 0.0% 9.82sec 156662 149.29sec
DStr_ID_Felguard DStr_ID_Felguard_vilefiend melee 0 192928 1292 43.21 1525 3049 107.5 107.5 17.7% 0.0% 0.0% 0.0% 2.71sec 275813 149.29sec
DStr_ID_Felguard DStr_ID_Felguard_illidari_satyr melee 0 18173 1180 182.53 329 659 46.9 46.9 17.7% 0.0% 0.0% 0.0% 2.75sec 25980 15.40sec
DStr_ID_Felguard DStr_ID_Felguard_illidari_satyr melee_oh 0 9089 590 182.53 165 329 46.9 46.9 17.8% 0.0% 0.0% 0.0% 2.75sec 12994 15.40sec
DStr_ID_Felguard DStr_ID_Felguard_illidari_satyr shadow_slash 272012 28223 1833 39.35 2374 4742 10.1 10.1 17.8% 0.0% 0.0% 0.0% 13.10sec 28223 15.40sec
DStr_ID_Felguard DStr_ID_Felguard_dreadstalker dreadbite 205196 210363 1956 16.15 6176 12357 28.9 28.9 17.7% 0.0% 0.0% 0.0% 21.06sec 210363 107.54sec
DStr_ID_Felguard DStr_ID_Felguard_dreadstalker melee 0 454655 4228 173.57 1242 2484 311.1 311.1 17.7% 0.0% 0.0% 0.0% 1.90sec 649984 107.54sec
DStr_ID_Felguard DStr_ID_Felguard_wild_imp fel_firebolt 104318 901026 10428 831.04 640 1280 1201.7 1196.8 17.7% 0.0% 0.0% 0.0% 0.24sec 901026 86.41sec
DStr_ID_Felguard DStr_ID_Felguard_demonic_tyrant demonfire 270481 245350 4649 42.69 5548 11101 37.6 37.5 17.8% 0.0% 0.0% 0.0% 6.88sec 245350 52.77sec
DStr_ID_Felguard DStr_ID_Felguard_void_terror double_breath 272156 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 11.16sec
DStr_ID_Felguard DStr_ID_Felguard_void_terror double_breath1 272156 21852 1958 42.16 2366 4733 7.8 7.8 17.8% 0.0% 0.0% 0.0% 17.86sec 21852 11.16sec
DStr_ID_Felguard DStr_ID_Felguard_void_terror double_breath2 272156 21827 1956 42.16 2366 4730 7.8 7.8 17.7% 0.0% 0.0% 0.0% 17.86sec 21827 11.16sec
DStr_ID_Felguard DStr_ID_Felguard_void_terror melee 0 36624 3282 254.13 659 1318 47.3 47.3 17.6% 0.0% 0.0% 0.0% 2.80sec 52359 11.16sec
DStr_ID_Felguard DStr_ID_Felguard_wrathguard melee 0 35930 2355 182.47 659 1318 46.4 46.4 17.6% 0.0% 0.0% 0.0% 2.77sec 51366 15.26sec
DStr_ID_Felguard DStr_ID_Felguard_wrathguard melee_oh 0 17960 1177 182.47 329 659 46.4 46.4 17.5% 0.0% 0.0% 0.0% 2.77sec 25676 15.26sec
DStr_ID_Felguard DStr_ID_Felguard_wrathguard overhead_assault 272432 20384 1336 38.41 1777 3556 9.8 9.8 17.4% 0.0% 0.0% 0.0% 13.53sec 29141 15.26sec
DStr_ID_Felguard DStr_ID_Felguard_urzul many_faced_bite 272439 22357 1699 48.70 1776 3551 10.7 10.7 17.8% 0.0% 0.0% 0.0% 12.20sec 31961 13.16sec
DStr_ID_Felguard DStr_ID_Felguard_urzul melee 0 37038 2815 217.65 659 1318 47.7 47.7 17.8% 0.0% 0.0% 0.0% 2.66sec 52950 13.16sec
DStr_ID_Felguard DStr_ID_Felguard_vicious_hellhound demon_fangs 272013 29144 1783 38.40 2373 4746 10.5 10.5 17.4% 0.0% 0.0% 0.0% 12.93sec 29144 16.34sec
DStr_ID_Felguard DStr_ID_Felguard_vicious_hellhound melee 0 17885 1094 337.95 165 330 92.1 92.1 17.7% 0.0% 0.0% 0.0% 1.42sec 25569 16.34sec
DStr_ID_Felguard DStr_ID_Felguard_bilescourge toxic_bile 272167 168792 11610 248.81 2380 4758 60.3 60.3 17.6% 0.0% 0.0% 0.0% 2.10sec 168792 14.54sec
DStr_ID_Felguard DStr_ID_Felguard_shivarra melee 0 36613 2596 200.94 659 1317 47.2 47.2 17.7% 0.0% 0.0% 0.0% 2.71sec 52342 14.10sec
DStr_ID_Felguard DStr_ID_Felguard_shivarra melee_oh 0 18304 1298 200.94 329 659 47.2 47.2 17.7% 0.0% 0.0% 0.0% 2.71sec 26167 14.10sec
DStr_ID_Felguard DStr_ID_Felguard_shivarra multislash 272172 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 14.10sec
DStr_ID_Felguard DStr_ID_Felguard_shivarra multislash1 272172 7568 537 32.80 835 1670 7.7 7.7 17.6% 0.0% 0.0% 0.0% 17.71sec 10820 14.10sec
DStr_ID_Felguard DStr_ID_Felguard_shivarra multislash2 272172 7577 537 32.80 835 1668 7.7 7.7 17.8% 0.0% 0.0% 0.0% 17.71sec 10832 14.10sec
DStr_ID_Felguard DStr_ID_Felguard_shivarra multislash3 272172 7565 536 32.80 835 1670 7.7 7.7 17.6% 0.0% 0.0% 0.0% 17.71sec 10815 14.10sec
DStr_ID_Felguard DStr_ID_Felguard_shivarra multislash4 272172 7575 537 32.80 835 1670 7.7 7.7 17.7% 0.0% 0.0% 0.0% 17.71sec 10829 14.10sec
DStr_ID_Felguard DStr_ID_Felguard_eye_of_guldan eye_of_guldan ticks -272131 24288 81 12.18 399 0 28.0 60.9 0.0% 0.0% 0.0% 0.0% 5.50sec 24288 11.44sec
DStr_ID_Felguard DStr_ID_Felguard_prince_malchezaar melee 0 78698 5652 92.54 3125 6238 21.5 21.5 17.3% 0.0% 0.0% 0.0% 1.75sec 112508 13.92sec
DStr_ID_Felguard DStr_ID_Felguard_prince_malchezaar melee_oh 0 39510 2838 92.54 1562 3119 21.5 21.5 17.8% 0.0% 0.0% 0.0% 1.75sec 56484 13.92sec
DStr_ID_Imp DStr_ID_Imp augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_ID_Imp DStr_ID_Imp berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.91sec 0 299.99sec
DStr_ID_Imp DStr_ID_Imp call_dreadstalkers 104316 0 0 0.00 0 0 14.6 0.0 0.0% 0.0% 0.0% 0.0% 21.04sec 0 299.99sec
DStr_ID_Imp DStr_ID_Imp demonbolt 264178 399538 1332 9.56 7114 14227 47.0 47.8 17.5% 0.0% 0.0% 0.0% 5.82sec 399538 299.99sec
DStr_ID_Imp DStr_ID_Imp flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_ID_Imp DStr_ID_Imp food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_ID_Imp DStr_ID_Imp hand_of_guldan 105174 329461 1098 12.55 4464 8914 62.9 62.7 17.7% 0.0% 0.0% 0.0% 4.72sec 329461 299.99sec
DStr_ID_Imp DStr_ID_Imp heed_my_call 271685 42676 142 1.47 4925 9849 7.3 7.3 18.0% 0.0% 0.0% 0.0% 36.63sec 42676 299.99sec
DStr_ID_Imp DStr_ID_Imp heed_my_call_aoe 271686 18245 61 1.47 2111 4221 7.3 7.3 17.8% 0.0% 0.0% 0.0% 36.63sec 18245 299.99sec
DStr_ID_Imp DStr_ID_Imp inner_demons 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_ID_Imp DStr_ID_Imp nether_portal 267217 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_ID_Imp DStr_ID_Imp potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_ID_Imp DStr_ID_Imp shadow_bolt 686 395144 1317 18.68 3593 7185 94.1 93.4 17.7% 0.0% 0.0% 0.0% 3.13sec 395144 299.99sec
DStr_ID_Imp DStr_ID_Imp summon_demonic_tyrant 265187 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.54sec 0 299.99sec
DStr_ID_Imp DStr_ID_Imp summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_ID_Imp DStr_ID_Imp summon_random_demon 0 0 0 0.00 0 0 17.8 0.0 0.0% 0.0% 0.0% 0.0% 14.61sec 0 299.99sec
DStr_ID_Imp DStr_ID_Imp summon_vilefiend 264119 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 47.18sec 0 299.99sec
DStr_ID_Imp DStr_ID_Imp volatile_blood_explosion 278057 86377 288 1.43 10240 20481 7.2 7.1 18.0% 0.0% 0.0% 0.0% 37.12sec 86377 299.99sec
DStr_ID_Imp DStr_ID_Imp_imp firebolt 3110 940722 3136 20.60 7759 15520 103.8 103.0 17.7% 0.0% 0.0% 0.0% 2.89sec 940722 299.99sec
DStr_ID_Imp DStr_ID_Imp_wrathguard melee 0 36887 2907 224.97 660 1320 47.6 47.6 17.5% 0.0% 0.0% 0.0% 2.76sec 52735 12.69sec
DStr_ID_Imp DStr_ID_Imp_wrathguard melee_oh 0 18447 1454 224.97 330 660 47.6 47.6 17.6% 0.0% 0.0% 0.0% 2.76sec 26372 12.69sec
DStr_ID_Imp DStr_ID_Imp_wrathguard overhead_assault 272432 21062 1660 47.56 1779 3557 10.1 10.1 17.7% 0.0% 0.0% 0.0% 13.50sec 30110 12.69sec
DStr_ID_Imp DStr_ID_Imp_void_terror double_breath 272156 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 14.11sec
DStr_ID_Imp DStr_ID_Imp_void_terror double_breath1 272156 22119 1568 33.83 2366 4729 8.0 8.0 17.5% 0.0% 0.0% 0.0% 17.34sec 22119 14.11sec
DStr_ID_Imp DStr_ID_Imp_void_terror double_breath2 272156 22153 1570 33.83 2366 4733 8.0 8.0 17.7% 0.0% 0.0% 0.0% 17.34sec 22153 14.11sec
DStr_ID_Imp DStr_ID_Imp_void_terror melee 0 36959 2619 202.69 660 1319 47.7 47.7 17.6% 0.0% 0.0% 0.0% 2.74sec 52837 14.11sec
DStr_ID_Imp DStr_ID_Imp_vilefiend bile_spit 267997 70880 473 2.74 8825 17651 6.8 6.8 17.6% 0.0% 0.0% 0.0% 47.18sec 163734 149.76sec
DStr_ID_Imp DStr_ID_Imp_vilefiend bile_spit ticks -267997 92854 310 6.69 2777 0 6.8 33.4 0.0% 0.0% 0.0% 0.0% 47.18sec 163734 149.76sec
DStr_ID_Imp DStr_ID_Imp_vilefiend headbutt 267999 109602 732 12.05 3100 6201 30.1 30.1 17.6% 0.0% 0.0% 0.0% 9.82sec 156689 149.76sec
DStr_ID_Imp DStr_ID_Imp_vilefiend melee 0 193444 1292 43.18 1526 3050 107.8 107.8 17.6% 0.0% 0.0% 0.0% 2.71sec 276551 149.76sec
DStr_ID_Imp DStr_ID_Imp_vicious_hellhound demon_fangs 272013 29405 3100 66.58 2373 4746 10.5 10.5 17.7% 0.0% 0.0% 0.0% 12.40sec 29405 9.49sec
DStr_ID_Imp DStr_ID_Imp_vicious_hellhound melee 0 17914 1888 582.82 165 331 92.1 92.1 17.6% 0.0% 0.0% 0.0% 1.37sec 25610 9.49sec
DStr_ID_Imp DStr_ID_Imp_dreadstalker dreadbite 205196 211388 1954 16.11 6175 12350 29.0 29.0 17.8% 0.0% 0.0% 0.0% 21.05sec 211388 108.20sec
DStr_ID_Imp DStr_ID_Imp_dreadstalker melee 0 456113 4215 172.95 1243 2486 311.9 311.9 17.7% 0.0% 0.0% 0.0% 1.89sec 652069 108.20sec
DStr_ID_Imp DStr_ID_Imp_urzul many_faced_bite 272439 22207 1765 50.75 1778 3551 10.6 10.6 17.4% 0.0% 0.0% 0.0% 12.74sec 31748 12.58sec
DStr_ID_Imp DStr_ID_Imp_urzul melee 0 36798 2925 225.96 660 1319 47.4 47.4 17.8% 0.0% 0.0% 0.0% 2.78sec 52607 12.58sec
DStr_ID_Imp DStr_ID_Imp_wild_imp fel_firebolt 104318 912997 9846 784.76 640 1279 1217.7 1212.8 17.7% 0.0% 0.0% 0.0% 0.24sec 912997 92.73sec
DStr_ID_Imp DStr_ID_Imp_demonic_tyrant demonfire 270481 246017 4653 42.66 5561 11121 37.7 37.6 17.7% 0.0% 0.0% 0.0% 6.88sec 246017 52.87sec
DStr_ID_Imp DStr_ID_Imp_shivarra melee 0 36840 3413 263.65 659 1319 47.4 47.4 17.8% 0.0% 0.0% 0.0% 2.78sec 52668 10.79sec
DStr_ID_Imp DStr_ID_Imp_shivarra melee_oh 0 18410 1706 263.65 330 660 47.4 47.4 17.7% 0.0% 0.0% 0.0% 2.78sec 26319 10.79sec
DStr_ID_Imp DStr_ID_Imp_shivarra multislash 272172 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 10.79sec
DStr_ID_Imp DStr_ID_Imp_shivarra multislash1 272172 7618 706 43.17 835 1670 7.8 7.8 17.5% 0.0% 0.0% 0.0% 18.07sec 10890 10.79sec
DStr_ID_Imp DStr_ID_Imp_shivarra multislash2 272172 7607 705 43.17 835 1672 7.8 7.8 17.3% 0.0% 0.0% 0.0% 18.07sec 10875 10.79sec
DStr_ID_Imp DStr_ID_Imp_shivarra multislash3 272172 7649 709 43.17 835 1670 7.8 7.8 17.9% 0.0% 0.0% 0.0% 18.07sec 10935 10.79sec
DStr_ID_Imp DStr_ID_Imp_shivarra multislash4 272172 7621 706 43.17 835 1670 7.8 7.8 17.5% 0.0% 0.0% 0.0% 18.07sec 10896 10.79sec
DStr_ID_Imp DStr_ID_Imp_darkhound fel_bite 272435 20915 1394 39.83 1779 3560 10.0 10.0 18.0% 0.0% 0.0% 0.0% 13.71sec 29901 15.00sec
DStr_ID_Imp DStr_ID_Imp_darkhound melee 0 36587 2439 188.48 660 1319 47.1 47.1 17.7% 0.0% 0.0% 0.0% 2.82sec 52305 15.00sec
DStr_ID_Imp DStr_ID_Imp_bilescourge toxic_bile 272167 168407 14326 306.96 2382 4764 60.2 60.1 17.6% 0.0% 0.0% 0.0% 2.13sec 168407 11.75sec
DStr_ID_Imp DStr_ID_Imp_illidari_satyr melee 0 17986 1304 201.63 330 660 46.3 46.3 17.7% 0.0% 0.0% 0.0% 2.75sec 25713 13.79sec
DStr_ID_Imp DStr_ID_Imp_illidari_satyr melee_oh 0 8998 652 201.63 165 330 46.3 46.3 17.8% 0.0% 0.0% 0.0% 2.75sec 12864 13.79sec
DStr_ID_Imp DStr_ID_Imp_illidari_satyr shadow_slash 272012 28040 2033 43.75 2375 4751 10.1 10.1 17.4% 0.0% 0.0% 0.0% 12.98sec 28040 13.79sec
DStr_ID_Imp DStr_ID_Imp_eye_of_guldan eye_of_guldan ticks -272131 24349 81 12.20 399 0 28.2 61.0 0.0% 0.0% 0.0% 0.0% 5.39sec 24349 16.23sec
DStr_ID_Imp DStr_ID_Imp_prince_malchezaar melee 0 79521 3986 64.92 3130 6250 21.6 21.6 17.7% 0.0% 0.0% 0.0% 1.59sec 113684 19.95sec
DStr_ID_Imp DStr_ID_Imp_prince_malchezaar melee_oh 0 39779 1994 64.92 1564 3132 21.6 21.6 17.8% 0.0% 0.0% 0.0% 1.59sec 56869 19.95sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
133897.1 0.0 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 12.45% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (0 - 10)_1:12.45%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 10.41% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (10 - 20)_1:10.41%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 9.90% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (20 - 30)_1:9.90%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 10.31% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (30 - 40)_1:10.31%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.96% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.96%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.14% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 13.01% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (60 - 70)_1:13.01%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.46% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.46%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 4.44% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (80 - 90)_1:4.44%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 5.92% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (90 - 100)_1:5.92%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bleeding_1:100.00%
Chaos Brand

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • chaos_brand_1:100.00%

Spelldata details

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your $?c1[Chaos][Fire] damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mystic_touch_1:100.00%

Spelldata details

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 133897.14
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 4999
Mean 299.99
Minimum 240.01
Maximum 359.96
Spread ( max - min ) 119.95
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 4999
Mean 135780.82
Minimum 128079.68
Maximum 145870.54
Spread ( max - min ) 17790.86
Range [ ( max - min ) / 2 * 100% ] 6.55%
Standard Deviation 3148.1238
5th Percentile 131206.61
95th Percentile 141627.34
( 95th Percentile - 5th Percentile ) 10420.74
Mean Distribution
Standard Deviation 44.5256
95.00% Confidence Intervall ( 135693.55 - 135868.09 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2066
0.1 Scale Factor Error with Delta=300 84604
0.05 Scale Factor Error with Delta=300 338414
0.01 Scale Factor Error with Delta=300 8460330
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 1436
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (123) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 32089156 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3336 3336 3336
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=123
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

\n\n